KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1481Help
Entry
HY04AAS1_1481     CDS       T00745                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HY04AAS1_1481
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HY04AAS1_1481
Enzymes [BR:hya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HY04AAS1_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1396928..1398319
Genome map
AA seq 463 aa AA seqDB search
MFTMNLDCKKYNITDNSKEVDKNTVFFAIRGVSKDGHDFIEEAIEKGAPYVVAEKPFKDF
KNIIVVEDSKKAFGECVKAHFDNPDEHLKVIGVTGTNGKTSTTHIIHAILSQKYKGGIIG
TMYYKLGNEVIEAPNTTPGVKTWFSLLSKAKEKGLDFVAAEVSSHALDQLRVYPTKFFAT
VFTNLTQDHLDYHKTMENYFNAKRRLFKDYEYEVCVLNIDDDYGSMLYEEFKDKAITYGY
SENAHLKIDYFDQENKVFGFYYKNKHYEIKTNLKGDFQAYNMGASILLGFYMGFDIEEIQ
RGILSLSSIPGRFETIELNGVKVVIDYAHTPDALEKLLKTAKAITKNRLICVFGAGGNRD
KTKRPKMGKIASELSDISIITSDNPRFEESMDIIKDILEGIDPSKGPMVEEDRKKAIALA
LDIALDGDVVVIAGKGHEDYQEIKGVKYHFSDKEEVLKYKNNT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaatgaatttagactgcaagaagtataatattacagacaactctaaagaggta
gataaaaatacggtattttttgctataagaggagtttcaaaagacggtcatgattttata
gaagaagccattgaaaaaggagctccttacgttgtagcagaaaaaccttttaaggatttt
aaaaatataatagtagtagaagattctaaaaaagcttttggagagtgtgtaaaagctcat
tttgacaacccagatgaacatctgaaggtcataggtgtcacagggaccaacggcaaaaca
agcaccacacatataatacacgctattttgtctcaaaaatataaaggtggtatcattggt
accatgtattataaattgggaaatgaggttatagaggccccaaacacgaccccaggtgtg
aaaacgtggtttagccttttatcaaaagccaaagaaaaagggcttgattttgtggcggca
gaagtatcttctcacgctttggatcaactcagggtttatcctacaaagttttttgccact
gtctttacaaatcttacccaagatcatcttgattatcataagaccatggaaaactatttc
aacgccaaaagaaggctttttaaagattatgagtatgaggtttgtgttttaaatatagac
gatgattacggtagcatgctttatgaggagtttaaagacaaagctataacttatgggtat
tcggaaaacgcccatctaaagatagattattttgatcaagaaaacaaggtttttggcttt
tactataaaaataaacattatgagattaagacaaacctaaaaggggattttcaagcttac
aacatgggagcaagtatacttcttggcttttatatggggtttgatatagaggagattcaa
agaggtattctttctttaagctcaataccaggaaggtttgaaacgatagagttaaacggt
gttaaggtggtaatagattatgctcatacaccagatgcccttgaaaagcttttaaaaacc
gcaaaagcaataaccaaaaaccgtcttatatgtgtctttggtgcaggtggaaaccgtgat
aaaaccaaaagaccaaagatgggcaaaatagcttcagaactttctgacatatcaataata
acctccgataatccaaggtttgaagagtcgatggatattatcaaagatatacttgagggt
atagacccatctaaagggcctatggtggaagaggaccgcaaaaaagccatagctttggct
cttgatatagcccttgatggtgatgtggtggtaatagctggtaaaggacatgaggattac
caggagataaaaggtgtgaaatatcattttagtgataaagaagaggtgctaaagtataaa
aataacacttag

DBGET integrated database retrieval system