KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1513Help
Entry
HY04AAS1_1513     CDS       T00745                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HY04AAS1_1513
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     HY04AAS1_1513
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     HY04AAS1_1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1426637..1427188)
Genome map
AA seq 183 aa AA seqDB search
MSHLVIYNEEGSVLELIKEYEAVSKRLAALGVRFERWKADNELSWDAGQKEVIKAYEEDI
NRIIKEFGFKSLDVVSLIPENPKKDELRNVFLKEHTHSDFEVRFFVDGSGTFYLHIDDKV
YVAFCEKGDFISVPAYTKHWFDMGSKPFFKAIRFFLIPEGWVADFTGSDISLKIPSHDDI
ASL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcttgtgatttacaatgaagaaggtagcgttttagagcttataaaagaatat
gaggcagtatcaaagagattggcagcattgggtgtaaggtttgaaaggtggaaagccgac
aatgaactttcctgggatgctggtcaaaaagaggtaataaaagcttatgaagaggatata
aatagaataataaaagagtttgggtttaaatctttggatgtagtaagcctaataccagaa
aatcctaaaaaagatgagttaagaaacgtgtttttaaaagaacatacgcactctgatttt
gaagtgaggttttttgtagatgggtcaggtactttttatcttcatatagatgataaagtt
tatgtggctttttgtgaaaaaggggactttataagtgtaccagcttatacaaaacattgg
tttgatatgggttcaaagccttttttcaaagctataagatttttcttgatacctgagggt
tgggtagcagattttacaggctctgatatatctttaaagattccaagccatgatgacata
gcctctctatga

DBGET integrated database retrieval system