KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1523Help
Entry
HY04AAS1_1523     CDS       T00745                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00010  Glycolysis / Gluconeogenesis
hya00260  Glycine, serine and threonine metabolism
hya00680  Methane metabolism
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
hya01120  Microbial metabolism in diverse environments
hya01130  Biosynthesis of antibiotics
hya01200  Carbon metabolism
hya01230  Biosynthesis of amino acids
Module
hya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hya_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_1523
  Energy metabolism
   00680 Methane metabolism
    HY04AAS1_1523
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HY04AAS1_1523
Enzymes [BR:hya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HY04AAS1_1523
Membrane trafficking [BR:hya04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HY04AAS1_1523
Exosome [BR:hya04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HY04AAS1_1523
  Exosomal proteins of melanoma cells
   HY04AAS1_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACG58206
JGI: HY04AAS11523
UniProt: B4U616
Position
complement(1436113..1436856)
Genome map
AA seq 247 aa AA seqDB search
MYTLVLLRHGQSLWNLENKFTGWIDVDLSDQGKEEAKNAGKAMLEAGITPKAAFTSYLRR
AINTLNIALDTMNLHYIDVFKSWRLNERHYGALQGLNKKEMVKIHGEEQVNIWRRNYDVP
PPPLPKDDPNHPCNDPRYKHIRCQDLPSSESLKDTLERTLPYFQDFIAPTLFQRGCVLVA
AHGNSLRAIVKYIEDLSKDEIVKLNIPTGIPLVYVVDDNLNIKSKRYLADEETLKKAIES
VANQTKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgttggtgcttttaagacatggacaaagcctttggaatttagagaacaagttt
acaggttggatagatgtagacttaagcgatcaaggtaaagaagaagctaagaatgccggt
aaggctatgcttgaggctggcataacaccaaaagccgcttttacgtcttatcttagaaga
gccataaatacgttaaacatagcccttgatacaatgaaccttcattatatagatgtcttt
aaaagctggagactaaacgaaagacattacggagcacttcaaggcctaaacaaaaaagaa
atggtaaaaatacacggagaagaacaagtaaacatatggagaagaaactacgatgttcct
ccacctccacttcccaaagatgacccaaaccacccatgcaacgacccaaggtataagcat
ataagatgtcaagatttaccatcctcagaatccttaaaagataccttagaaagaacgctt
ccttactttcaagattttatagcacccactctttttcaaagaggatgcgtattggtggcc
gctcacggaaactcccttagagccatagtaaaatacattgaagatttgagcaaagatgag
atagtaaaactaaatatacccactggtataccacttgtttatgtagtagatgataattta
aatataaaaagcaaaagatacttagcagatgaggaaacccttaaaaaagccatagaatct
gtggcaaatcaaacaaaagcatga

DBGET integrated database retrieval system