KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1597Help
Entry
HY04AAS1_1597     CDS       T00745                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
hya00250  Alanine, aspartate and glutamate metabolism
hya01100  Metabolic pathways
hya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HY04AAS1_1597
Enzymes [BR:hya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HY04AAS1_1597
Peptidases [BR:hya01002]
 Cysteine Peptidases
  Family C44
   HY04AAS1_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ACG58278
JGI: HY04AAS11597
UniProt: B4U6E2
Position
1515416..1517338
Genome map
AA seq 640 aa AA seqDB search
MCGILGLFGNPASLPRSKSIDTNLFKKALDKIAHRGPDAHGIYQNEDIIFGHRRLSIIDL
SPLGNQPMVDEETGDKGSTVNVIVFNGEIYNFKSIRDFLISKGINFNSSSDTEVLLKAYR
YFGVEVLSKLRGMFSFCIYDADKKSLFFARDRFGKKPFYYAFIKDNFLFSSEIKALLEFF
DKTPLPDKDSMADYFRYLAPSYGKTMYEGIYKLPPSCFGILDKNGLSIKEYYNPLDYLSK
SYQNEDQILKDIENKLIESIELRLVGDVEVASLLSGGLDSSFVSALYSKIAKETFGKNIN
TFSIGYSEYEHYSELDWALKVSKFIGSSHHPININSKDFIEKIDEVVYFLDEPINDPATL
PTYVISSYIKQNGIKVALSGEGSDELFFGYDLYYKYLNYEDISKSLKKPHKELILESLSD
KNLDVADLWDVADLSKASELLKRALKDEIIFRTIGECFTNDELKRFLRFSYESDNIELFS
KRFEPFSHHHISIWYYFVDMYMWIGEVLMMKVDKMAMAHSVELRAPMLDHELHQLVLNVD
PALRISNQNKHLLKKIAIKYLPEEIVYRRKKGFSYPFIEWFYKEKKNFLEDWLKINKEHG
FFDEGFLRFLYENGNSKAYKHHVWAVEIFNRWFKKTYLSN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatattgggactttttggaaatccagcaagtctgccacggtctaaatccata
gatacaaatctttttaaaaaagctttagataaaatagctcatagaggaccagatgctcat
ggtatctaccaaaacgaagatatcatatttggccatagaagactttctatcatagattta
tcgcctttgggcaatcagcctatggtggatgaagaaacaggcgacaagggttccacggtt
aatgttatcgtttttaacggagagatctataattttaaatccataagggattttttaata
tcaaaaggaataaactttaactcatcttcggacaccgaagtgcttttaaaagcttataga
tattttggtgtagaggtccttagcaagctaagaggtatgttttctttttgtatatacgat
gcagataaaaaatctctcttttttgcaagggataggtttggtaaaaaacccttttattat
gcttttataaaagataactttttattttcatcggagataaaagcactgcttgagtttttt
gacaaaacgccacttccagataaagattctatggcagattattttagatatttggcccct
tcttatggaaagactatgtatgagggtatatataagcttcctccttcttgttttgggatt
ttagataaaaatgggcttagtataaaagagtattacaatccccttgattatctttctaaa
agctatcaaaacgaagatcaaatactaaaagatatagaaaataagcttatagaatctatt
gagcttaggcttgtgggagatgtggaagtggcatcgcttctttctggaggtcttgattct
tcttttgtaagcgctttgtattcaaagatcgccaaagaaacatttggtaaaaatataaac
acattttctatagggtacagcgagtatgagcactacagcgagcttgattgggctttgaaa
gtttcaaagtttattggatcaagccatcatcctatcaacataaactcaaaggattttata
gagaaaatagatgaggtggtttattttttagatgagcctataaacgatcctgccactttg
cccacatacgttatatcttcttacatcaaacaaaacggtataaaagttgctctttctgga
gagggttctgatgagctattttttggatacgatctttattataagtatctaaactatgaa
gatatctctaaaagcctaaaaaaacctcataaagaacttatattagaatcactttcagac
aagaatttggacgtggcagacttgtgggacgtggcagacttgtctaaagcatcggagctt
ttaaaaagagctttaaaagatgagattatctttaggactataggggagtgttttacaaac
gatgagcttaaaaggtttttaagattttcttatgagagtgataatattgagctattttca
aaaagatttgagcctttttctcatcatcatatatctatatggtattactttgtagatatg
tatatgtggataggggaagtgcttatgatgaaagtggataaaatggctatggctcattct
gtagaactaagagcacctatgcttgatcatgaacttcatcagcttgtgttaaatgtagat
ccagcacttcgtatatcaaaccaaaacaaacaccttcttaagaaaatagctataaaatat
ctaccagaagagatagtgtatagaaggaaaaagggattttcttatccatttatagaatgg
ttttacaaagaaaagaaaaactttttggaagattggcttaagataaacaaagaacatgga
ttttttgatgaagggtttttgagatttttatatgaaaatggtaattcaaaagcttacaaa
caccacgtctgggcggtggagatatttaatagatggtttaagaaaacttatctatccaat
tga

DBGET integrated database retrieval system