KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1597Help
Entry
HY04AAS1_1597     CDS       T00745                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hya00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1515416..1517338
Genome map
AA seq 640 aa AA seqDB search
MCGILGLFGNPASLPRSKSIDTNLFKKALDKIAHRGPDAHGIYQNEDIIFGHRRLSIIDL
SPLGNQPMVDEETGDKGSTVNVIVFNGEIYNFKSIRDFLISKGINFNSSSDTEVLLKAYR
YFGVEVLSKLRGMFSFCIYDADKKSLFFARDRFGKKPFYYAFIKDNFLFSSEIKALLEFF
DKTPLPDKDSMADYFRYLAPSYGKTMYEGIYKLPPSCFGILDKNGLSIKEYYNPLDYLSK
SYQNEDQILKDIENKLIESIELRLVGDVEVASLLSGGLDSSFVSALYSKIAKETFGKNIN
TFSIGYSEYEHYSELDWALKVSKFIGSSHHPININSKDFIEKIDEVVYFLDEPINDPATL
PTYVISSYIKQNGIKVALSGEGSDELFFGYDLYYKYLNYEDISKSLKKPHKELILESLSD
KNLDVADLWDVADLSKASELLKRALKDEIIFRTIGECFTNDELKRFLRFSYESDNIELFS
KRFEPFSHHHISIWYYFVDMYMWIGEVLMMKVDKMAMAHSVELRAPMLDHELHQLVLNVD
PALRISNQNKHLLKKIAIKYLPEEIVYRRKKGFSYPFIEWFYKEKKNFLEDWLKINKEHG
FFDEGFLRFLYENGNSKAYKHHVWAVEIFNRWFKKTYLSN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatattgggactttttggaaatccagcaagtctgccacggtctaaatccata
gatacaaatctttttaaaaaagctttagataaaatagctcatagaggaccagatgctcat
ggtatctaccaaaacgaagatatcatatttggccatagaagactttctatcatagattta
tcgcctttgggcaatcagcctatggtggatgaagaaacaggcgacaagggttccacggtt
aatgttatcgtttttaacggagagatctataattttaaatccataagggattttttaata
tcaaaaggaataaactttaactcatcttcggacaccgaagtgcttttaaaagcttataga
tattttggtgtagaggtccttagcaagctaagaggtatgttttctttttgtatatacgat
gcagataaaaaatctctcttttttgcaagggataggtttggtaaaaaacccttttattat
gcttttataaaagataactttttattttcatcggagataaaagcactgcttgagtttttt
gacaaaacgccacttccagataaagattctatggcagattattttagatatttggcccct
tcttatggaaagactatgtatgagggtatatataagcttcctccttcttgttttgggatt
ttagataaaaatgggcttagtataaaagagtattacaatccccttgattatctttctaaa
agctatcaaaacgaagatcaaatactaaaagatatagaaaataagcttatagaatctatt
gagcttaggcttgtgggagatgtggaagtggcatcgcttctttctggaggtcttgattct
tcttttgtaagcgctttgtattcaaagatcgccaaagaaacatttggtaaaaatataaac
acattttctatagggtacagcgagtatgagcactacagcgagcttgattgggctttgaaa
gtttcaaagtttattggatcaagccatcatcctatcaacataaactcaaaggattttata
gagaaaatagatgaggtggtttattttttagatgagcctataaacgatcctgccactttg
cccacatacgttatatcttcttacatcaaacaaaacggtataaaagttgctctttctgga
gagggttctgatgagctattttttggatacgatctttattataagtatctaaactatgaa
gatatctctaaaagcctaaaaaaacctcataaagaacttatattagaatcactttcagac
aagaatttggacgtggcagacttgtgggacgtggcagacttgtctaaagcatcggagctt
ttaaaaagagctttaaaagatgagattatctttaggactataggggagtgttttacaaac
gatgagcttaaaaggtttttaagattttcttatgagagtgataatattgagctattttca
aaaagatttgagcctttttctcatcatcatatatctatatggtattactttgtagatatg
tatatgtggataggggaagtgcttatgatgaaagtggataaaatggctatggctcattct
gtagaactaagagcacctatgcttgatcatgaacttcatcagcttgtgttaaatgtagat
ccagcacttcgtatatcaaaccaaaacaaacaccttcttaagaaaatagctataaaatat
ctaccagaagagatagtgtatagaaggaaaaagggattttcttatccatttatagaatgg
ttttacaaagaaaagaaaaactttttggaagattggcttaagataaacaaagaacatgga
ttttttgatgaagggtttttgagatttttatatgaaaatggtaattcaaaagcttacaaa
caccacgtctgggcggtggagatatttaatagatggtttaagaaaacttatctatccaat
tga

DBGET integrated database retrieval system