KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1631Help
Entry
HY04AAS1_1631     CDS       T00745                                 

Definition
Alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HY04AAS1_1631
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_1631
  Lipid metabolism
   00071 Fatty acid degradation
    HY04AAS1_1631
  Amino acid metabolism
   00350 Tyrosine metabolism
    HY04AAS1_1631
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HY04AAS1_1631
   00626 Naphthalene degradation
    HY04AAS1_1631
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HY04AAS1_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1550560..1551567
Genome map
AA seq 335 aa AA seqDB search
MKAAICKEFKKPLVIEDIPIPEIGPDEVLIKVKYCGICHSDLHIVDGDWESWVKLPVVPG
HEVAGIVEKVGSNVKNVKEGDRVGMPWLYSSCEICDYCVEGEEPLCPNHEITGITRQGGY
AEYMKAPSHFVTKIPDKLELSYAAPLFCAGITVYAALVRLNLKPNELVVIQGIGGLGHLA
IQYAKAMGAKVVALSHSDKEKVAKELGADYFINSSKQDPVKELKALGGADTILTTVYDSK
SIQNLVDALAPKGRLSVVGAAQEPIYVNPFDLITKRIVITGSAIGGRKLLREMLEFSAFN
NIKPIIQEYKFEDVNKALDDLRSGKIVLRGVLKFN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctatctgtaaagaatttaaaaagcctttggtgatagaagatataccaata
ccagagataggtcccgatgaggtgcttataaaggtcaagtattgcggtatatgtcatagc
gatcttcatatagtggatggagactgggaatcttgggtaaaacttcctgttgtaccagga
cacgaagtagctggtattgtagaaaaagtaggtagcaacgtcaaaaatgttaaagaaggt
gatagggttggaatgccttggctttattcttcttgtgagatatgcgattactgtgtagaa
ggagaagaacccctttgtccaaaccatgagatcacaggtatcacccgccaaggtggctat
gcagagtatatgaaagccccgtctcattttgttacaaaaatcccagataaacttgaactt
tcttatgccgctcctttattttgcgcaggtataacagtttatgccgctcttgtaaggtta
aatttaaaaccaaatgagttagtggtaatccaaggtataggtggtcttggtcatttggct
attcagtatgctaaagctatgggtgctaaggtagtagcactaagccattctgataaagaa
aaagtggctaaagagcttggggcagattattttataaactcatcaaagcaagacccagta
aaagagctaaaagccttaggtggggcagatactatacttacaaccgtttatgattctaaa
agcatacaaaatcttgtagacgctttagcaccaaaaggtagattgtcagtggtaggtgct
gcccaagaaccaatatatgtaaatccctttgatctcataacaaaacgtatcgtgataact
ggttctgccataggtggaagaaagcttttaagggagatgcttgagttttcggcttttaac
aacataaaacccatcattcaagagtacaagtttgaagatgtaaacaaagcgctcgatgat
ctaagatctggtaaaatagtattaagaggcgtattaaaatttaactaa

DBGET integrated database retrieval system