KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1631Help
Entry
HY04AAS1_1631     CDS       T00745                                 

Definition
Alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:hya01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hya00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hya00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hya00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:hya00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:hya00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1550560..1551567
Genome map
AA seq 335 aa AA seqDB search
MKAAICKEFKKPLVIEDIPIPEIGPDEVLIKVKYCGICHSDLHIVDGDWESWVKLPVVPG
HEVAGIVEKVGSNVKNVKEGDRVGMPWLYSSCEICDYCVEGEEPLCPNHEITGITRQGGY
AEYMKAPSHFVTKIPDKLELSYAAPLFCAGITVYAALVRLNLKPNELVVIQGIGGLGHLA
IQYAKAMGAKVVALSHSDKEKVAKELGADYFINSSKQDPVKELKALGGADTILTTVYDSK
SIQNLVDALAPKGRLSVVGAAQEPIYVNPFDLITKRIVITGSAIGGRKLLREMLEFSAFN
NIKPIIQEYKFEDVNKALDDLRSGKIVLRGVLKFN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctatctgtaaagaatttaaaaagcctttggtgatagaagatataccaata
ccagagataggtcccgatgaggtgcttataaaggtcaagtattgcggtatatgtcatagc
gatcttcatatagtggatggagactgggaatcttgggtaaaacttcctgttgtaccagga
cacgaagtagctggtattgtagaaaaagtaggtagcaacgtcaaaaatgttaaagaaggt
gatagggttggaatgccttggctttattcttcttgtgagatatgcgattactgtgtagaa
ggagaagaacccctttgtccaaaccatgagatcacaggtatcacccgccaaggtggctat
gcagagtatatgaaagccccgtctcattttgttacaaaaatcccagataaacttgaactt
tcttatgccgctcctttattttgcgcaggtataacagtttatgccgctcttgtaaggtta
aatttaaaaccaaatgagttagtggtaatccaaggtataggtggtcttggtcatttggct
attcagtatgctaaagctatgggtgctaaggtagtagcactaagccattctgataaagaa
aaagtggctaaagagcttggggcagattattttataaactcatcaaagcaagacccagta
aaagagctaaaagccttaggtggggcagatactatacttacaaccgtttatgattctaaa
agcatacaaaatcttgtagacgctttagcaccaaaaggtagattgtcagtggtaggtgct
gcccaagaaccaatatatgtaaatccctttgatctcataacaaaacgtatcgtgataact
ggttctgccataggtggaagaaagcttttaagggagatgcttgagttttcggcttttaac
aacataaaacccatcattcaagagtacaagtttgaagatgtaaacaaagcgctcgatgat
ctaagatctggtaaaatagtattaagaggcgtattaaaatttaactaa

DBGET integrated database retrieval system