KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_1636Help
Entry
HY04AAS1_1636     CDS       T00745                                 

Definition
thiamine pyrophosphate TPP binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HY04AAS1_1636
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HY04AAS1_1636
   00020 Citrate cycle (TCA cycle)
    HY04AAS1_1636
   00620 Pyruvate metabolism
    HY04AAS1_1636
   00640 Propanoate metabolism
    HY04AAS1_1636
   00650 Butanoate metabolism
    HY04AAS1_1636
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HY04AAS1_1636
   00680 Methane metabolism
    HY04AAS1_1636
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HY04AAS1_1636
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HY04AAS1_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1555697..1556557
Genome map
AA seq 286 aa AA seqDB search
MSFNIYKVNEELRDFMPPEILELEGKATWGNPKRGVMDLPYAKELLEEHSLCAGCPESDA
FRYILASLPNPEDTIIVNSTGCTSLVFPHIALHTVHSLFGNQNAVASGIKRVLEYRFPDK
VKDVVVLAGDGATVDIGLDCTLQSFFRQEKITTICYDNEVYANTGGQESGLTVKGHVFKM
APKGKQWDKVPMWQLAIDSGCHYVVRMTVSSPRRVEQAVKKAIYVAREVGPTYIHLYTPC
ILEIGRNADEGLEEMKLGDKERFSFFEHMSPQAEEVIKAKKEEGLI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaatatatacaaagtaaacgaagagcttagagattttatgcctccagaaata
ctggagctagagggaaaagccacttggggcaatcctaaaaggggcgtaatggatttgccc
tatgcaaaagagttgttagaagagcattctctttgtgcagggtgtccagagtcggatgct
tttagatatatacttgcatctttaccaaacccagaagataccataattgtaaattctacc
gggtgcacatcacttgtgtttccacatatagccttacatacagtgcactctttgtttgga
aaccaaaatgcggtagccagcggtataaaaagggttttagagtatagatttccagataaa
gtaaaggatgtcgtagtgttggcgggcgatggtgctactgttgatataggtttagattgt
acattgcaatcttttttcagacaagaaaaaatcaccactatatgctacgataacgaagtt
tatgcaaataccggtggtcaagaaagcggtctcacggtgaaaggccacgtatttaagatg
gctcccaagggtaaacagtgggataaggtccctatgtggcaacttgctatagattcaggt
tgtcattatgtggtaaggatgacagtctcatcacctcgtagggttgaacaagctgtaaaa
aaagctatatacgtagctagagaagtaggtccaacatatattcatctttataccccttgc
atacttgaaataggaagaaatgccgatgaaggcttagaagagatgaagcttggtgataaa
gaaaggttttctttctttgagcatatgagtcctcaggctgaagaagttatcaaagcaaag
aaggaggaaggtttaatatga

DBGET integrated database retrieval system