KEGG   Hydrogenophaga sp. RAC07: BSY239_166Help
Entry
BSY239_166        CDS       T04455                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hyr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSY239_166
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSY239_166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
197040..198623
Genome map
AA seq 527 aa AA seqDB search
MTRAELLESLPRHGVFDLAVVGGGATGLGVALDAALRGFSVVLLESHDFAGGTSSRSTKL
LHGGVRYLAQGNLALVREALAERATVLRIAPHLAQPLPFVMPSYKWWQTPFYGIGLKLYD
MLAGSAGLGRTEFLSRSQTLQALPGVNPEGLRGGVKYWDGQFDDARLALALARSAEAAGA
QVVNYAEVTAVRQLAGGDAPLSSLDVKDRLGSATLQLQARCVVNATGVWVDALRDHTQPP
AHPGTPSRMVSPSQGVHVVVDRDFMPGGHALLVPKTRDGRVLFAVPWLGKLVLGTTDTPR
RDLPREPDAFAEELEFILSEASQALSRPVRREDIKSLWVGLRPLVAAPAAAEGGTKVLSR
EHTIVVDPNGLVTVTGGKWTTYRAMAEDVLERCFASRLLPRRAGGQSEAHVLRGAAVASP
ATPLHAAPGLHLYGSDGAQVNECPGQNNTLGAGVTEAMVRYAARFEHARTVEDVLARRSR
ILFLDAAEAARMAPAVAGILQQELGSDPALGAFLDLCTRYLPSSAAN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgcagaactgcttgaatcgctcccccgccacggcgtttttgacctggcggtc
gtcggtggtggtgccaccggactcggggtggcgctcgacgcggcactgcgcggtttctcg
gtggtgctgctggagtcgcacgactttgccggcggcacctcgtcgcgatccaccaaactg
ctgcacggcggcgtgcgctacctggcgcagggcaacctggccctggtgcgcgaagccctg
gcggagcgggccacggtgctgcgcatcgcgccccacctcgcgcaaccgctgcccttcgtc
atgccgtcctacaagtggtggcagaccccgttttacggcatcggcctcaagctctacgac
atgctggccggcagcgccgggctgggccgcaccgaattcctcagccgctcgcagaccctg
caggccctgcccggggtgaaccccgagggcttgcgcggtggcgtcaagtactgggacggc
cagttcgacgatgcgcgcctcgcgctggcgctggcccgcagcgccgaggccgcgggggcc
caggttgtgaactatgccgaagtgacggcggtgcgccagctcgccgggggcgacgccccc
ctgtcgtcgctggacgtgaaggaccgactcggcagcgccacgttgcagttgcaggcccgc
tgcgtggtcaacgccaccggtgtctgggtcgacgcgctgcgcgaccacacccagccgccc
gcccacccgggcacaccctcgcgcatggtcagccccagccagggcgtgcacgtggtggtg
gaccgcgacttcatgcccggcggccacgcactgctggtgcccaagacgcgcgacggccgc
gtgctgttcgccgtgccgtggttgggcaaactggtgctgggcaccaccgacaccccgcgc
cgggacctgccgcgcgagcccgatgcctttgccgaagagctcgaattcatcctcagcgag
gccagccaggctctgagccggccggtgcgccgtgaagacatcaagagcctctgggtgggc
ctgcgacccctggtggccgcacccgccgcagccgagggtggcaccaaggtgctgtcgcgc
gaacacaccatcgtggtcgaccccaacggcctggtcaccgtgaccgggggcaaatggacc
acctaccgcgccatggcggaagacgtgctggagcgatgcttcgccagccggctgctgccc
cggcgcgcgggcggccagagcgaagcgcatgtgctcaggggcgctgccgtggccagtcca
gccacgcccctgcacgcggcgcccggcctgcacctgtacgggtccgacggggcgcaggtc
aacgaatgccccgggcaaaacaacaccctgggggctggcgtgaccgaagccatggtgcgt
tacgccgcccgcttcgagcacgcccggacggtggaggatgtgctcgcccgccgctcgcgc
atcctgttcctggatgccgccgaagccgcccggatggcgcccgccgtggccggcatcctg
cagcaggagctgggctcggacccggccctgggcgcatttctggacctgtgcacccgctat
ctgccctcgtccgcagcgaattag

DBGET integrated database retrieval system