KEGG   Hydrogenophaga sp. RAC07: BSY239_3631Help
Entry
BSY239_3631       CDS       T04455                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00071  Fatty acid degradation
hyr00072  Synthesis and degradation of ketone bodies
hyr00280  Valine, leucine and isoleucine degradation
hyr00310  Lysine degradation
hyr00362  Benzoate degradation
hyr00380  Tryptophan metabolism
hyr00620  Pyruvate metabolism
hyr00630  Glyoxylate and dicarboxylate metabolism
hyr00640  Propanoate metabolism
hyr00650  Butanoate metabolism
hyr00900  Terpenoid backbone biosynthesis
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
hyr01120  Microbial metabolism in diverse environments
hyr01130  Biosynthesis of antibiotics
hyr01200  Carbon metabolism
hyr01212  Fatty acid metabolism
hyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hyr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY239_3631
   00630 Glyoxylate and dicarboxylate metabolism
    BSY239_3631
   00640 Propanoate metabolism
    BSY239_3631
   00650 Butanoate metabolism
    BSY239_3631
  Lipid metabolism
   00071 Fatty acid degradation
    BSY239_3631
   00072 Synthesis and degradation of ketone bodies
    BSY239_3631
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY239_3631
   00310 Lysine degradation
    BSY239_3631
   00380 Tryptophan metabolism
    BSY239_3631
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY239_3631
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY239_3631
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSY239_3631
Enzymes [BR:hyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY239_3631
Exosome [BR:hyr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY239_3631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOF85167
UniProt: A0A1B3LWE0
Position
complement(3850672..3851856)
Genome map
AA seq 394 aa AA seqDB search
MSQDPIVIVGAARTPMGSFQSDFASLSAHDLGGAAIKAAVERAGVKPEQVDEVLFGNCLM
AGQGQAPARQAAFKGGLPKSAGAVTLSKMCGSGMKATMLAHDMILAGSASVMVAGGMESM
TNAPYLMLKGRGGYRMGHDKIYDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFTREQQDA
FAIASVTRAKAATENGAFAAEITPVTVKDRSGERVVSTDEGPGKVKLDKVTSLKPAFKKD
GTITAASSSSINDGAAALVLMRESTAKAQGLKPLARIVAHSTHAQEPNWFATAPVGATQK
LLAKTGWSVNEVDLWEINEAFAVVPMALMTELNIPHEKVNVNGGACALGHPIGASGARIL
VTLLHALQARGGKKGVATLCIGGGEATAMAIELA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagaccccatcgtcatcgtcggcgccgcccgcacccccatgggctcgttccag
agcgacttcgccagcctctccgcccacgacctgggtggcgccgccatcaaggcagcggtc
gagcgcgccggcgtgaagcccgagcaggtggacgaagtgctgttcggcaactgcctgatg
gccggccagggccaggcacccgcgcgccaggccgctttcaagggcggtctgccgaaatcg
gccggcgccgtgacgctgtccaagatgtgcggctcgggcatgaaggccaccatgctcgcg
cacgacatgatccttgccggcagcgccagcgtgatggtggccggcggcatggagagcatg
accaacgcgccctacctgatgctcaagggtcgcggcggctaccgcatggggcacgacaag
atttacgaccacatgatgctggacggcctggaagacgcctacgaggccggccgctcgatg
ggcaccttcggcgaagactgcgcggccaagtacagcttcacccgcgagcagcaggacgcc
tttgccattgcctcggtcacgcgcgccaaggccgccaccgagaacggcgcctttgccgcc
gagatcacgcccgtgacggtgaaggaccgcagtggcgagcgcgtggtgtccaccgacgaa
ggcccgggcaaggtcaagctcgacaaggtcaccagcctcaagcccgcgttcaagaaagac
ggcaccatcaccgccgcgtcgagctcgtccatcaacgacggtgctgccgcgctggtgctc
atgcgcgaatccaccgcgaaggctcagggcctgaagccactggcgcgcatcgtggcgcac
agcacccacgcccaggaacccaactggttcgccaccgccccggtgggcgccacgcagaag
ctgctggccaaaaccggctggagcgtgaatgaggtggacctgtgggagatcaacgaagcc
ttcgccgtggtgcccatggcgctcatgaccgagctgaacatcccgcacgagaaggtcaac
gtcaacggcggcgcctgcgcgctgggtcaccccatcggcgccagcggtgcgcgcattctg
gtgacgctgctgcacgcgctgcaggcgcgtggcggcaagaagggcgtggccacgctgtgc
atcggcggcggtgaagccacggcgatggcgattgagctggcttga

DBGET integrated database retrieval system