KEGG   Hydrogenobaculum sp. SN: HydSN_0025Help
Entry
HydSN_0025        CDS       T02516                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hys00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(21871..22419)
Genome map
AA seq 182 aa AA seqDB search
MIDKEKIIQGIKLFLEGIGEDITREGIKETPERVARMWEEFEKERSFDFKLFEEYSNYSE
MIIVKDIPFYSMCEHHLLPFFGKAHIAYIPNKKICGLSKLVRTVRAMALKPQVQERLTEE
IADIVQKELEPMGAGVVIEAEHLCMSMRGVRSPGHCTVTSSLRGSFLSDIRTKEEFFKLI
RQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgacaaagaaaagatcatacaaggtataaagcttttcttagaaggtataggagaa
gatatcacaagagaaggcataaaagaaaccccagaaagagtcgctaggatgtgggaggag
tttgaaaaagagagatcctttgattttaagctttttgaagagtacagcaactattctgaa
atgattatcgtaaaagatatacctttttatagtatgtgcgagcatcatcttttaccattt
tttggaaaagctcatatagcctatataccaaacaaaaagatatgtgggctatctaaactt
gtaagaactgtaagggctatggctttaaaaccacaagtccaagaaagacttacagaggaa
atagccgatatagtccaaaaagaattagaaccaatgggagctggtgtcgtaatagaggca
gagcatctttgtatgtctatgagaggagtaagatcaccaggacattgcaccgtcacttcc
tctttaaggggaagctttttaagcgatattagaacaaaggaggagtttttcaaacttata
agacaatga

DBGET integrated database retrieval system