KEGG   Hydrogenobaculum sp. SN: HydSN_0037Help
Entry
HydSN_0037        CDS       T02516                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hys  Hydrogenobaculum sp. SN
Brite
Enzymes [BR:hys01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HydSN_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31026..31850)
Genome map
AA seq 274 aa AA seqDB search
MDLSIKSNNERAVLLLHGLTGTPLELRWVARDFAKANYDVYFPILPGHCSSLEDLKKTKW
EELYEFAKNFYLDLKAKYNQVFVAGLCVGGMLSLMLGMEFPDIDGVGSWAPAMDIDGWAI
PWYRFLLPLGLYTPLKHIYYWKEKEPFGIKNEAMRRKIMQMMKAEKNEAMAYDKIPAPTI
VELKRMAKYIKKHVNLLKAPFILIHSKEDDLSSIKGAKYIYEKAPSQVKKFVELSNSYHI
VTMDNEKDIVSGETINFFNFLTEIKRQKLEVYQV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggatctttctataaaaagcaacaacgaaagagcagtgttgcttcttcacggacttact
ggtacacctttagagctaagatgggtggccagagattttgccaaggcaaattacgatgta
tattttccaatactacctggtcattgttctagccttgaagatcttaaaaaaaccaaatgg
gaggagctttacgagtttgccaaaaatttttatcttgatttaaaagctaaatacaaccaa
gtatttgtggctgggctatgcgtaggcggtatgctctctcttatgcttggtatggagttt
cctgatatagacggtgttggctcttgggcaccagcaatggatatagatggatgggcaata
ccttggtatagatttttactaccacttggactttatacaccgttaaaacatatttactat
tggaaagagaaagaaccctttggcataaaaaatgaagccatgagaagaaaaatcatgcag
atgatgaaagctgaaaaaaatgaagccatggcatacgataaaataccagctcccactata
gtagaactaaaacgaatggctaaatatattaaaaagcatgtaaatctcttaaaagcaccg
tttatcttaattcattcaaaagaagacgacttatcttctataaaaggggcaaagtatata
tacgaaaaagctccaagtcaggttaaaaagtttgtagaactttcaaacagctatcacatc
gtgactatggacaacgaaaaagacatagtttcaggtgaaacaataaattttttcaacttt
ttaacagaaataaagcgtcaaaagttagaagtgtatcaggtgtaa

DBGET integrated database retrieval system