KEGG   Hydrogenobaculum sp. SN: HydSN_0461Help
Entry
HydSN_0461        CDS       T02516                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hys01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hys00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(387911..388942)
Genome map
AA seq 343 aa AA seqDB search
MIFVIKIGSNVLSTEGGDFDISFISSIAEDIKTLQKEHIKFLIVSSGAVMAGKKILNIKG
DSILSRQILASVGQSRLMSLYDNIFSNYNLTISQILITSDIFTNQNMFSNAQRTIEGLLD
HNIIPIINENDAIATEELIFGDNDFLSVYVSYISKASKLVIFSTAGGLYTKDGKTLIREV
SDFEEAFKEVNPSKSTFGSGGMLSKLQASMMASNIGIEVFITSKSQRLIDIYTDKAIGTK
IPPKQNSKLKPKDLIKLAQYSKGIIYIDEGAKKALLNRKALLAIGIKGFDGVFKKGDIVS
ISDEQGIMIGKGKVQYDSKELKNIIGKKNKEVIKTDDIYIIHI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgttatcaaaattggttcaaacgtcttatccacagagggaggggattttgat
ataagctttatctcctccatcgccgaggatataaaaactctacaaaaagaacatatcaag
tttcttatagtatcctccggggccgtcatggctggaaaaaaaatcctaaatataaaagga
gattctatcctttcaagacaaatactcgcctctgttggccaatcgaggcttatgtctttg
tacgacaacatattttcaaattataaccttactataagtcaaatacttataacctctgat
atttttacaaatcaaaacatgttttcaaacgcccaaaggacgatagaaggactcttagat
cacaacatcatacccattataaacgaaaacgacgccatagccaccgaagagcttatcttt
ggagataacgattttttaagcgtttatgtatcttatatatcaaaagcctcaaaacttgta
atattttcaactgccggcgggctttatacaaaagatggcaaaaccctcataagagaagta
tcagattttgaagaggccttcaaagaggtaaacccctccaaaagcacctttggaagcggt
ggcatgcttagcaaactccaagcttccatgatggcatcaaacatcggtatagaggttttt
ataacctctaaaagccaaagacttatagatatatacactgacaaagccataggcacaaaa
ataccaccaaaacaaaactcaaaactaaaaccaaaagatcttatcaaattggcccagtat
tcaaaaggcatcatatacatagatgaaggggctaaaaaagcacttttaaacagaaaagca
ctccttgccataggtataaaaggttttgatggagttttcaaaaaaggggatatagtaagt
atatcagacgaacaaggtattatgataggtaaaggaaaagtccagtacgattccaaagag
ctaaaaaatataataggtaaaaaaaacaaagaagtcataaaaacagacgatatctatatc
atacacatataa

DBGET integrated database retrieval system