KEGG   Hydrogenobaculum sp. SN: HydSN_0616Help
Entry
HydSN_0616        CDS       T02516                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hys00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HydSN_0616
Enzymes [BR:hys01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HydSN_0616
Exosome [BR:hys04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HydSN_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537246..539138
Genome map
AA seq 630 aa AA seqDB search
MAYKYNYDISLLTDEDLYLFNEGTHYHLYEKLGAHVLEGGVYFAVWAPNAKEVYVEGSFN
FWNKKEYPLRPKGSSGIWEIFIEDLKSYELYKYYIVSNFGYELEKRDPFAFYTEVPPKSA
GIIYDISGYQWKDESWLLKRKNSNHYKEPISIYEVHLGSWRRTLENGFLSYKDIAHQLVE
YVKDMGFTHVEFLPIMEHPFYGSWGYQTLSYFAPTSRYGEPKDFMYLVDFLHQNDIGVIL
DWVPSHFATDDYGLSFFDGTHLYEHMDKRKGYHPDWGSYIFNYGRHEVRAFLISSANFWF
DKYHVDGIRVDAVASMLYLDYSRKEGEWEPNIYGGKENLEAIDFLRKLNETVYIFNPGIF
TVAEESTAWPMVTKPTYIGGLGFGFKWDMGWMHDTLRYFSKDPIHRKYHQQDITFRMLYA
FNENFILPLSHDEVVHGKGSLIGKMPGDYWQKFANLRLLLSYMYGSPGKKLLFMGSEFGQ
FDEWNHDKSLDWHLLEFDSHKGIQNLVRDLNKIYKNETALHELDHDPEGFEWIDFQDVEQ
SIFSFLRKAKNGDFVICIFNATPVPRHDYKIGVPKPGFYKEILNSDSIYYWGSNVGNAGL
IEAHAEPWHKFNFSISLTLPPLGALFLKLA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaatacaattacgatataagccttttaaccgacgaagatttgtatcttttc
aacgaagggacacattatcatctttatgaaaagcttggggcccatgtgcttgaaggtgga
gtatactttgccgtgtgggctccaaatgccaaagaagtttatgtagaaggtagttttaac
ttttggaataaaaaagaataccctttaagacctaaaggaagctctggcatatgggaaatt
tttatagaagatcttaaaagctatgaactttataagtattacatagtctcaaactttgga
tacgagctagaaaaaagagatccattcgctttttacacagaagtcccaccaaaaagtgcc
ggcatcatttacgatatatctggctatcaatggaaagatgaatcatggcttttaaaaaga
aaaaactcaaaccactacaaagaacccataagcatatacgaagtacatcttggctcttgg
agaaggacgttagaaaacggatttttatcttataaggatatagcccatcagcttgtagag
tatgtaaaagatatgggatttacccatgtagagtttttacccattatggaacatcctttt
tacgggtcttggggatatcaaacgctttcttactttgctccgacatctagatatggagag
ccaaaagattttatgtatcttgtggattttctgcaccaaaacgatataggagtaatactt
gattgggtaccatctcattttgccacagacgattatggactttctttctttgacgggact
catctttacgagcacatggacaaaagaaaaggatatcacccagattggggaagctatata
tttaactatggaagacatgaggttagagcgtttttaataagtagtgccaacttttggttt
gacaaatatcatgtagatggtataagagtagatgccgttgcctccatgctttatcttgat
tattcaagaaaagaaggcgaatgggaaccaaatatttacggtggtaaagaaaatttagaa
gctattgattttctgaggaaactaaatgaaacagtatatatctttaatcctgggatattt
acagtagcagaagaatccaccgcttggcccatggttacaaaacctacttacataggtggg
cttggatttggtttcaaatgggatatgggctggatgcatgatactttgagatatttttcc
aaagacccaatacatagaaaatatcatcaacaagatataacgtttagaatgctttacgct
tttaacgaaaacttcatattaccgctctctcacgatgaggtggtgcatggaaaaggttct
ttgataggaaaaatgcccggtgattactggcaaaaatttgcaaatttaagacttttactg
tcttatatgtatggaagtcctggcaaaaagcttctttttatgggtagtgagtttggccaa
tttgatgaatggaatcacgataaaagcttggactggcatcttttagagtttgattcgcat
aaaggtatacaaaatttggtaagagatttaaataaaatttacaaaaacgaaacagcttta
catgaattagatcacgatccagaaggttttgaatggattgattttcaagacgtagagcaa
tctattttttcatttttaagaaaagccaaaaacggtgatttcgtaatctgtatttttaac
gctactcctgttccaagacatgattataaaataggtgttccaaaaccaggtttttataaa
gaaatattaaattcagactctatctactattggggttctaacgtcggaaatgctggactc
atagaagcgcatgctgaaccttggcataagtttaacttttccataagcttaacgcttcca
ccgttaggagcgctatttttaaaattagcttaa

DBGET integrated database retrieval system