KEGG   Hydrogenobaculum sp. SN: HydSN_0616Help
Entry
HydSN_0616        CDS       T02516                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hys00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537246..539138
Genome map
AA seq 630 aa AA seqDB search
MAYKYNYDISLLTDEDLYLFNEGTHYHLYEKLGAHVLEGGVYFAVWAPNAKEVYVEGSFN
FWNKKEYPLRPKGSSGIWEIFIEDLKSYELYKYYIVSNFGYELEKRDPFAFYTEVPPKSA
GIIYDISGYQWKDESWLLKRKNSNHYKEPISIYEVHLGSWRRTLENGFLSYKDIAHQLVE
YVKDMGFTHVEFLPIMEHPFYGSWGYQTLSYFAPTSRYGEPKDFMYLVDFLHQNDIGVIL
DWVPSHFATDDYGLSFFDGTHLYEHMDKRKGYHPDWGSYIFNYGRHEVRAFLISSANFWF
DKYHVDGIRVDAVASMLYLDYSRKEGEWEPNIYGGKENLEAIDFLRKLNETVYIFNPGIF
TVAEESTAWPMVTKPTYIGGLGFGFKWDMGWMHDTLRYFSKDPIHRKYHQQDITFRMLYA
FNENFILPLSHDEVVHGKGSLIGKMPGDYWQKFANLRLLLSYMYGSPGKKLLFMGSEFGQ
FDEWNHDKSLDWHLLEFDSHKGIQNLVRDLNKIYKNETALHELDHDPEGFEWIDFQDVEQ
SIFSFLRKAKNGDFVICIFNATPVPRHDYKIGVPKPGFYKEILNSDSIYYWGSNVGNAGL
IEAHAEPWHKFNFSISLTLPPLGALFLKLA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaatacaattacgatataagccttttaaccgacgaagatttgtatcttttc
aacgaagggacacattatcatctttatgaaaagcttggggcccatgtgcttgaaggtgga
gtatactttgccgtgtgggctccaaatgccaaagaagtttatgtagaaggtagttttaac
ttttggaataaaaaagaataccctttaagacctaaaggaagctctggcatatgggaaatt
tttatagaagatcttaaaagctatgaactttataagtattacatagtctcaaactttgga
tacgagctagaaaaaagagatccattcgctttttacacagaagtcccaccaaaaagtgcc
ggcatcatttacgatatatctggctatcaatggaaagatgaatcatggcttttaaaaaga
aaaaactcaaaccactacaaagaacccataagcatatacgaagtacatcttggctcttgg
agaaggacgttagaaaacggatttttatcttataaggatatagcccatcagcttgtagag
tatgtaaaagatatgggatttacccatgtagagtttttacccattatggaacatcctttt
tacgggtcttggggatatcaaacgctttcttactttgctccgacatctagatatggagag
ccaaaagattttatgtatcttgtggattttctgcaccaaaacgatataggagtaatactt
gattgggtaccatctcattttgccacagacgattatggactttctttctttgacgggact
catctttacgagcacatggacaaaagaaaaggatatcacccagattggggaagctatata
tttaactatggaagacatgaggttagagcgtttttaataagtagtgccaacttttggttt
gacaaatatcatgtagatggtataagagtagatgccgttgcctccatgctttatcttgat
tattcaagaaaagaaggcgaatgggaaccaaatatttacggtggtaaagaaaatttagaa
gctattgattttctgaggaaactaaatgaaacagtatatatctttaatcctgggatattt
acagtagcagaagaatccaccgcttggcccatggttacaaaacctacttacataggtggg
cttggatttggtttcaaatgggatatgggctggatgcatgatactttgagatatttttcc
aaagacccaatacatagaaaatatcatcaacaagatataacgtttagaatgctttacgct
tttaacgaaaacttcatattaccgctctctcacgatgaggtggtgcatggaaaaggttct
ttgataggaaaaatgcccggtgattactggcaaaaatttgcaaatttaagacttttactg
tcttatatgtatggaagtcctggcaaaaagcttctttttatgggtagtgagtttggccaa
tttgatgaatggaatcacgataaaagcttggactggcatcttttagagtttgattcgcat
aaaggtatacaaaatttggtaagagatttaaataaaatttacaaaaacgaaacagcttta
catgaattagatcacgatccagaaggttttgaatggattgattttcaagacgtagagcaa
tctattttttcatttttaagaaaagccaaaaacggtgatttcgtaatctgtatttttaac
gctactcctgttccaagacatgattataaaataggtgttccaaaaccaggtttttataaa
gaaatattaaattcagactctatctactattggggttctaacgtcggaaatgctggactc
atagaagcgcatgctgaaccttggcataagtttaacttttccataagcttaacgcttcca
ccgttaggagcgctatttttaaaattagcttaa

DBGET integrated database retrieval system