KEGG   Hydrogenobaculum sp. SN: HydSN_0646Help
Entry
HydSN_0646        CDS       T02516                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hys  Hydrogenobaculum sp. SN
Brite
Enzymes [BR:hys01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HydSN_0646
Secretion system [BR:hys02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HydSN_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565125..565952
Genome map
AA seq 275 aa AA seqDB search
MNIKFKKAKFLKPSLVLALAIFGIGLNACSKLQTTKCPSNNTIITNVEHFTPPGAKVQVV
AEKPLKQIKGLCEVVIKINGGPPNVIYTDPKGNYFIAGQLLNAITKQNLTEETASQFLKV
SKNEESGLNQYVAFSYYKGKSYFGTNPPPAEKYIYLITDPKCPFCHEAEPLIQKWADKNG
VEVRVILFPLPIHPGAFQSAVGLWCNKKGWNSLHDAYNAKAPMSQCPQGEAFIKNSMQEA
MKLGVQGTPTIIGMDGKMHPGAPSSEKQLDQWLGK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaaatttaaaaaagctaaatttttaaagccaagtttagtgcttgcgttagct
atttttggtattggtttaaatgcttgtagcaaacttcaaactacaaaatgcccttctaac
aacactataattacaaacgtagagcattttacaccaccaggggcaaaggtccaagtggta
gcagaaaaacctttaaaacaaataaaaggcctttgtgaagtggttataaaaataaacggt
gggccaccaaatgttatatatactgatccaaaaggaaactactttatagctggtcagctt
ctaaacgctattacaaagcaaaatcttacagaagaaactgcgagccagttcttaaaagta
agcaaaaatgaagaatcaggactaaatcagtatgtagcttttagttattacaaaggaaaa
tcttattttggtacaaatccaccaccagcagagaaatacatatatctaattaccgatcct
aaatgtccattttgccacgaggcagaacctcttatacaaaaatgggcagataaaaatggc
gtagaagtaagagttatacttttcccactgccaatacatccaggagctttccaatcagct
gtagggctttggtgcaacaaaaaaggatggaacagcctacacgatgcttacaacgcaaaa
gcacctatgtctcaatgccctcaaggagaagcttttatcaaaaactctatgcaagaagct
atgaaacttggagtccaaggtacacccactattataggcatggatggtaaaatgcatcca
ggagccccaagtagtgaaaaacaattagaccagtggttaggtaaataa

DBGET integrated database retrieval system