KEGG   Hydrogenobaculum sp. SN: HydSN_1059Help
Entry
HydSN_1059        CDS       T02516                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hys00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HydSN_1059
Enzymes [BR:hys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HydSN_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(960624..961181)
Genome map
AA seq 185 aa AA seqDB search
MDFIKAEILKVAKLSFKEGLVNAFAGNISYSYKNYMYITKRGSFFGDLTEKDIIKIDLKK
DKISEKASSEASVHKAIYLNTGKKAILHTHPKYTVLASFLYDKIVPIDSEGKLIFGQVKV
LDVDPPSASKALEEALSFALKEYNIAIVKTHGVFAASRNLMEAYAYTGALEHSCFMLLKA
KNMIK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggatttcataaaagctgagatactaaaagttgcaaaactaagttttaaagagggtttg
gtgaatgcttttgctgggaacataagctattcgtataaaaactatatgtatataactaaa
agaggctctttttttggagatctaacggaaaaagatataataaaaatagatctaaaaaaa
gataaaatatcagaaaaagcttcttctgaagcctcagttcacaaagccatatatctaaac
acaggtaaaaaagctatactccatacccatccaaagtatactgtccttgcatcgttttta
tacgataagattgtaccgatagactccgaaggaaagcttatatttgggcaagtcaaggtg
ttggatgtagatccaccatctgcatcaaaagctttagaagaagccctttcttttgcatta
aaagaatacaatatagcgatagtaaaaacccatggtgtttttgccgcttcaagaaatctt
atggaagcttacgcttataccggggctttggagcattcttgttttatgcttttaaaagcc
aaaaacatgataaaatga

DBGET integrated database retrieval system