KEGG   Hydrogenobaculum sp. SN: HydSN_1167Help
Entry
HydSN_1167        CDS       T02516                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hys00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HydSN_1167
Enzymes [BR:hys01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HydSN_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051212..1052537
Genome map
AA seq 441 aa AA seqDB search
MKDAVVIGAGVSGIVAAYTLKKAGFDPLVIEKEPHIGGSTHTLREDGRIIELGVQSVLGQ
DEFMAFAKELNLKPLHPPKEHANTRYVYLNGQLKRMPSNPIEFLTSDFFSIFGKIRLLRE
PFIPPKDDLKESISDFVTRRLGKEFLDKIVEPFVCGIYAGDPDKLSAKYAVRRVKALEDE
YGSIIKGSMKKKALGPQGEITSFEGGLLTFLEKMASGIDISLENVALKITKKDDIYTIDT
KSGKIQTKSILIATPAYSASYLLRNLTWSMSAELDQIEYAPVIVISAIVKHTLPKGFGFL
IPRKENTIMLGALFSSNLFKICKEDENIITIYVGGERRKDVADWPEEKILSEVKKELKKI
LGIEDFEKYYFKKWKKAIPQYNIGYERFINTVKDIENMNKGVFIAGNYIEGNSFNDSLRY
AMKKANEQILFLKKGVAHAQV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgccgttgtaataggtgcaggtgttagtggaatagtagcagcttatacgctt
aaaaaagctggttttgatcctcttgttatagaaaaagagcctcacataggtggttctacc
catactttgagagaagatggccgtatcatagagcttggcgtacaatctgtgcttggccaa
gatgagtttatggcttttgccaaagaactaaatctaaaacctctacatccaccaaaagag
cacgccaacacaagatacgtatatttaaacggtcaacttaaaaggatgccatcaaacccg
attgagtttttaacctccgattttttttctatatttggtaaaatcaggcttttaagagag
ccatttataccaccaaaagacgatctcaaagaaagtataagcgattttgtaacaaggcgt
cttggtaaagagtttttggataagatagtagaaccctttgtatgcggtatatacgctgga
gacccggataagctgtctgccaaatacgccgttagaagggtaaaagccttagaagatgaa
tatgggtctatcataaaaggttctatgaagaaaaaagcccttggccctcaaggagagatc
acatcttttgaaggtgggcttttaacatttttagaaaaaatggcttctggcatagatata
tctttggaaaatgtggcacttaaaatcactaaaaaagatgatatatatactatagatact
aaaagcggtaaaattcaaacaaaatctatactaatagccacaccagcctacagtgcatct
tatcttcttagaaatctcacttggagcatgtctgcggaattagaccagatagagtatgca
cctgttatagtgataagtgctatcgtaaaacatacccttccaaagggttttgggttttta
ataccaagaaaagaaaataccatcatgcttggagcacttttttcaagcaatctatttaaa
atctgcaaagaagatgagaatattatcactatatatgtaggcggtgaaagaagaaaagat
gtagcagattggccagaggaaaagatattgtccgaagtgaaaaaagagcttaaaaaaatc
cttggtatagaggattttgaaaaatattatttcaaaaaatggaaaaaagccatacctcag
tacaacataggctacgagagatttataaacacagtaaaggatatagagaacatgaacaaa
ggtgtgtttatagcaggaaactatattgaaggtaattcttttaacgattctttaagatac
gccatgaaaaaagcaaacgaacagattttatttcttaaaaaaggagtggctcatgcacaa
gtttaa

DBGET integrated database retrieval system