KEGG   Ignisphaera aggregans: Igag_0116Help
Entry
Igag_0116         CDS       T01307                                 

Definition
fructose-bisphosphate aldolase (EC:3.1.3.11 4.1.2.13)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_0116
   01230 Biosynthesis of amino acids
    Igag_0116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_0116
   00030 Pentose phosphate pathway
    Igag_0116
   00051 Fructose and mannose metabolism
    Igag_0116
  Energy metabolism
   00680 Methane metabolism
    Igag_0116
Enzymes [BR:iag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Igag_0116
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Igag_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104936..106093
Genome map
AA seq 385 aa AA seqDB search
MSEKAKTTISVIKADIGSLAGHHVVHPDTMAAAAKVLAEAKSKGIIVDYYITHVGDDLEL
IMTHRKGVDAPEVHEVAWNAFKEAAKVAKELGLYAAGQDLLTDAFSGNVRGLGPSAAEME
FVERPAEPVIVFMADKTEPGAFNLPLFRVFGDPFNTAGLVIDPKLHDGFKFEVYDVIGGK
YVIMNLPEEMYDLLALIGTPGRFVVRRVYRKSDNEIAAVVSVERLNLIAGQYVGKDDPVA
IVRAQSGFPAVGEVIEAFAFPHLVAGWMRGSHFGPLMPVSQRNARCTRFDGPPRVVALGF
QIKNARLIGPADLFDDPAYDETRRLAQTIAEYMRRHGPFMPHRLGPEEMEYTTLPAVLQK
LQNRFVEAKLYEVKGPKVKTELLHE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaaagctaaaacaacaatatctgttataaaggcagatatagggtcattagca
ggacatcatgtagttcatccagatactatggcagctgcagcaaaggttcttgcggaggct
aagagtaagggtattatagttgattattacataactcatgttggtgacgacctagaattg
ataatgacccatagaaaaggtgtagatgcaccagaagtacatgaagtagcttggaatgcc
tttaaagaggctgcaaaagttgcaaaagagcttggattatatgcagcaggacaagatctc
ttaacagatgctttctcaggcaatgtaaggggtctaggtccatcagctgcagaaatggag
tttgtagagagacctgctgaacccgtgattgtgttcatggctgataaaacagaacctggg
gcatttaatttaccattgtttagagtctttggagatccattcaatactgcaggccttgta
atagatcctaagcttcatgatggcttcaaattcgaggtttatgatgttattggaggtaaa
tatgtgataatgaatctacccgaggaaatgtatgatctccttgcattaataggcacccct
ggaagatttgtagtaaggagggtatacagaaaaagtgacaatgaaatagcagcagtagta
tctgtagagaggctaaatcttattgcaggacaatatgtcggtaaagacgatcccgtagct
attgtaagagcacagtcaggatttcctgctgtaggtgaagttatagaagcttttgcattt
ccacatctagttgcaggttggatgagaggaagtcactttggaccattaatgcctgttagt
cagaggaatgcaagatgtacaagatttgacggaccaccaagagtagttgcactaggattc
cagataaagaatgctagattaataggtccagcagatctattcgatgaccctgcatatgat
gagacaagaagattggcccaaactattgcagaatatatgagaagacatggaccatttatg
ccacataggttaggacctgaagagatggagtatacaaccctaccagctgttcttcagaag
ctacagaatagatttgttgaagcaaaactatatgaggttaaaggacctaaagtgaaaaca
gagctccttcatgaataa

DBGET integrated database retrieval system