KEGG   Ignisphaera aggregans: Igag_0117Help
Entry
Igag_0117         CDS       T01307                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_0117
   01230 Biosynthesis of amino acids
    Igag_0117
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_0117
   00051 Fructose and mannose metabolism
    Igag_0117
   00562 Inositol phosphate metabolism
    Igag_0117
Enzymes [BR:iag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Igag_0117
Exosome [BR:iag04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Igag_0117
  Exosomal proteins of bladder cancer cells
   Igag_0117
  Exosomal proteins of melanoma cells
   Igag_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106149..106841
Genome map
AA seq 230 aa AA seqDB search
MKHLKVPVLAINFKAYPTSFGVKALEIAKAAEKVAQEYGVEVIVIPPATELRKIVESVSI
PVYAQHADPYEYGAYTGWLPVVALKDIGVRGILVNHSEHRLRLDEIVAIVEAAKKYGLET
LVCADTPIAAAAIAAIKPVALAVEPPELIGTGIAVSKAKPEVITNTVQRVREVNKEVIIL
TGAGISTAEDVEAAIRLGTAGVLVASAIMKAQNPEKVIKDMAAVAKAAYK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatttgaaggtacctgtcttagctataaacttcaaagcctatcctacatcattt
ggagtaaaagctcttgaaatagctaaagctgcagaaaaagtggcgcaagaatatggtgta
gaggttatagttattccaccagcaacagaacttaggaaaatagttgaaagcgttagcata
ccagtttatgctcagcatgcagatccttatgaatatggtgcttatactggttggctacct
gtggtagcattgaaggatataggtgtaagaggaatattggtaaatcatagtgaacataga
cttagactagatgagatagtagctatagttgaagctgcaaaaaaatatgggctagagaca
ctagtatgtgcagatacaccaatagctgctgcagcaatagcagcaataaaacctgtcgca
cttgcagttgaacccccagaacttataggaacaggtatagcagtttcaaaagcaaaaccc
gaagtaataactaacactgtacagagggttagagaagtgaataaggaagtaataatttta
actggcgcaggcatctcaacagcagaagatgttgaggccgcaattagactaggaacagca
ggggtactagtggcatcagctataatgaaagcacaaaatccagaaaaagtaattaaagat
atggctgcagtagcaaaagcagcatataaataa

DBGET integrated database retrieval system