KEGG   Ignisphaera aggregans: Igag_0224Help
Entry
Igag_0224         CDS       T01307                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
iag  Ignisphaera aggregans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Igag_0224
Enzymes [BR:iag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Igag_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188381..189490
Genome map
AA seq 369 aa AA seqDB search
MNFFVKNGEIYKLDGATGKPKIIYLFGVNWFGFETRDYVVHGLWARNWVDMLQQIKSLGF
NAIRLPFCTYSVQEGTMPNSNAINYNINPDLQGLTSIEIMEKIVAKANELGIYILLDYHR
LGCDQIEPLWYSDQVSEQQFIDTWVSVAKRFAKYPNVIGADIRNEPWGATWGTDDPATDW
RLAVEKVAPKILEVAPHWLIFVEGTYKTRPDIDERSWYPYYSYYVFWGENLRAVRYYPVR
LPYEKIVYSPHTYGPDVFRQPYFDDPIFPENMRSIWMERFGYVKTELGYALVVGEFGGRY
GHGGDPRDIIWQIKFVDWLIENRICNFFYWSWNANSGDTGGILKDDWTNIWEDKYQNLKR
LMDYCSSIN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctttgttaaaaatggtgaaatatacaaattagatggagctactggaaaaccc
aagattatatatttatttggtgttaattggtttggttttgagacgagggactatgttgtt
catggtttgtgggctaggaattgggttgatatgttgcagcagattaagagtcttgggttt
aatgctattagattgcctttctgtacatattctgttcaggaaggtacaatgccaaatagt
aatgcgattaactataacattaatccagatcttcaaggtcttacatctatagagattatg
gagaagattgttgcgaaggctaatgaacttggtatatatatattgcttgattatcatagg
cttggctgcgatcagatagagcctctgtggtattctgatcaagtgagtgaacagcagttt
atagatacatgggtaagtgttgcaaagagatttgcaaaatatccaaatgttataggtgca
gatattagaaatgagccatggggagccacatggggtacagatgacccagcaacagattgg
agactagcagtagagaaagtagctccaaagattcttgaggtagctccacactggctaata
tttgtagaggggacatataaaacaagaccagatatagatgaaaggagttggtatccatat
tattcatattatgtattttggggagaaaatcttagggctgttagatactacccagttaga
ctgccatatgagaaaatagtgtattcaccacatacatatgggccagatgtatttcgtcaa
ccatattttgatgaccctatatttccagagaatatgcgtagcatatggatggagcgattc
ggctatgtaaaaactgaattgggatacgcattagtagtaggagaatttggtggaaggtat
ggccatggtggagatccaagggatattatatggcaaataaaatttgttgattggttgata
gagaataggatatgtaacttcttctactggagctggaatgcaaatagtggcgatacaggt
ggtattctaaaggatgactggacaaatatctgggaagataaataccaaaacctgaagcgg
cttatggactattgtagttcaattaattag

DBGET integrated database retrieval system