KEGG   Ignisphaera aggregans: Igag_0259Help
Entry
Igag_0259         CDS       T01307                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
iag  Ignisphaera aggregans
Pathway
iag00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Igag_0259
Enzymes [BR:iag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Igag_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADM27108
UniProt: E0SQN4
Position
219893..220843
Genome map
AA seq 316 aa AA seqDB search
MVIISVVGSIHMDFYIKLPKLPQPDETVMGYGFTMMPGGKGANQAVCAARLGAKTYMIGR
VGKDIFGERALQSLASAGVNIDYVAIDEEAHTGIAFILLNTAGENMIAVAPGTDYRVSER
DVDRAIDVIKQSDSLLLQLEIPINTVVYAAKIAYRHGVRVLLNPAPAMALPKELYSYIDV
LVPNRTEAEMLTSIKINSIDDAVKAGRELIGMGVENVIITMGNRGAVIVSKDFYHHVPAF
KVDVVDTTGAGDVFVAALGVFLSRGMDIVSACRYACAAAALKISRMGAQSAPTLDEVENF
IRQHQLISSVKIYGVS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggttataatatctgttgttggaagcatacatatggatttctatataaagttgccaaaa
cttcctcaaccagatgaaacagtaatgggctatggatttactatgatgccagggggcaag
ggcgcaaatcaagctgtatgtgcagcaaggctcggtgcaaagacatatatgattggacgt
gttggtaaagatatttttggtgaaagagcactacaatcattggcttcagcaggtgtaaat
atagattatgtggcgatagatgaggaagcccatacaggaatagcattcattcttctcaat
acagctggcgagaatatgatagctgtagcaccaggaacagattatagagtttcagagaga
gatgttgatagagctatagatgtaataaaacaatcagattcattactattacaacttgag
ataccgatcaatactgttgtatatgcagctaaaattgcttatagacatggtgttagagta
ttactcaatcctgcaccagctatggccctacctaaagagctctatagctatatagatgtc
ttagttcctaatagaacagaagcagagatgctaacatccatcaaaataaatagtattgat
gatgcagtaaaagctgggagagaattaatagggatgggtgtagagaatgttattattaca
atggggaatagaggagcggtaatagtgtccaaggacttttatcaccatgtaccagcattt
aaggtagatgttgttgatacaacaggtgctggagatgtttttgtcgccgctcttggagta
tttctatctaggggcatggatatagttagtgcatgtagatatgcctgtgcagctgcagca
ctaaagataagtagaatgggagctcaatctgccccaacattagatgaggtagagaatttc
attagacaacatcaattgattagtagtgtgaaaatatatggagttagttaa

DBGET integrated database retrieval system