KEGG   Ignisphaera aggregans: Igag_0346Help
Entry
Igag_0346         CDS       T01307                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
iag  Ignisphaera aggregans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Igag_0346
   00051 Fructose and mannose metabolism
    Igag_0346
Enzymes [BR:iag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Igag_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302004..303116
Genome map
AA seq 370 aa AA seqDB search
MARLDLSQLDRYIGFIKGEDIDRFLSEFNIKLASGTWAAGDFSDRFMRGGYNPDIDTSIV
GQLKRIREAGFIAYVPIDVQFKDRNLRIDWSVVENVKSISRELELKPIALAMDISGVNMF
KHGSIANPCEDLRKRALEVLTESMDIAKALGVDTVSFWPGQDGWDYSFEVNYGKMLKIFM
NNLKELAIRAADRGLTLGIEAKVKEPREGNMIIPTSHASILMAKRINDELGKKVVGITID
YGHELMYAVEPAYTVYLAKEFDVPLLSIHINTAKTHSNDEDRVVGTGDLWQFIDFLYATV
DIGFDGWYALDQFTYRMNPVEGLRKSKLFFVNAYKKALLLYRYRDELEKLREEADQGKIL
EFVGEIIYSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctagattagatctaagtcagttggatagatatatagggtttataaagggggaggat
atagatagattcttaagcgaattcaatataaaacttgcttcaggtacatgggctgcagga
gatttttcagataggtttatgagagggggatataatcctgatatagatactagtattgtt
ggacaactgaagagaattagagaagcagggtttatagcatatgttcctatagatgtacag
tttaaggatagaaatctcaggatagattggagtgttgtagagaatgttaagagtatttct
agggagcttgaattaaaacctatagctctagctatggatatatctggtgtcaatatgttt
aagcatgggagtattgcaaatccctgcgaagatcttagaaagagggcattagaggtattg
acagagtctatggatatagccaaggcattgggtgtagatacagtatctttctggcctggt
caagatggatgggattatagttttgaggtaaattatggaaagatgctgaagatatttatg
aacaatttgaaggagttagctattagagctgctgatagaggtcttactctaggtattgag
gctaaggttaaggagcctagggaaggaaatatgattataccaacatctcatgcttcaata
cttatggctaaaaggataaatgatgaacttggtaagaaggttgtaggtataactatagat
tatggacatgagcttatgtatgctgttgaacctgcatatactgtctatcttgctaaagaa
tttgatgtgcctttgctatcaatacatataaatacagcaaagacgcatagcaatgatgag
gatagagttgttggaacaggagatctatggcaatttatagactttctatatgcaactgta
gatataggattcgatggatggtatgcattagaccaatttacatataggatgaaccctgta
gagggattgaggaagtcaaagctattctttgtaaatgcatataaaaaagcattactattg
tatagatatagagatgaattagagaaacttagagaagaagcagaccagggaaagattcta
gagtttgttggagaaattatctatagcaaatag

DBGET integrated database retrieval system