KEGG   Ignisphaera aggregans: Igag_0370Help
Entry
Igag_0370         CDS       T01307                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
iag  Ignisphaera aggregans
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Igag_0370
  Lipid metabolism
   00561 Glycerolipid metabolism
    Igag_0370
   00600 Sphingolipid metabolism
    Igag_0370
Enzymes [BR:iag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Igag_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(325555..326454,326456..327067)
Genome map
AA seq 503 aa AA seqDB search
MSQGPKISFIGAGSARWTSRILVDIFMNKDLHNAEIWLMDIDDRRLNIIDTLARRLVNEL
KLPIKVYATKDRRKAIKDADFVISTALPKGYTYYETMRDISEKYGYYRGINSVEWNMVAD
YHTIWGYYLFKLHLDIARDIEELAPNAWFFIVSNPVLELTTMIARETKVKVAGICHGFLG
FRAAIEVLAMRLSKQMLGKDITSYCAAHMPECYDYMAKVIDFSDIEIEMKGLNHDIWLTR
FRYKGEDTYKYIDEWIKEDAEKYWSVWREYTTNPWNLDLCPAAIDMYRTYGLLPIGDTVR
GGTWKYHWDLKTKQYWYGQYGEPDSEIGCAIRIQIVRRNIEEMANIAFNMSTPVSQRISL
KPSGEVIVSLIDSIYNDKHTESYEINVPRIGSVKAPIYVNVLNNGSVPGIPDNVAVETHV
RVDGKGIHPIQTSGLPSKVFKYAILPRIMRLEWALEANLKGGRDTLVEWLIVDVRTNSMK
QVNDVIDAILSMPGNEEIAKHFS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggtcctaaaatctcatttattggagcaggaagtgcacgttggacaagtaga
attttagttgatatattcatgaataaggatcttcataatgctgagatatggcttatggat
atagatgatagaagacttaatataatagatacccttgctagaaggcttgtaaacgaattg
aaattgcctataaaggtctatgcaactaaggatagaaggaaggctataaaagacgcagat
tttgtaatatctacagctttacccaagggatacacatattatgaaactatgagggatatt
tctgagaaatatggctattataggggtattaatagtgttgagtggaatatggttgcagat
tatcacaccatatggggctactacttatttaagcttcatctagatattgctagagatata
gaggagttagctccaaatgcatggttcttcatagtatcgaaccccgttttagagcttaca
acaatgattgctagagagactaaggtaaaagttgctggtatatgtcatggcttcttaggc
tttagagcagctattgaggttcttgcaatgaggttatctaaacagatgctagggaaagat
ataacttcctattgtgctgcacatatgccagagtgctatgattatatggctaaggtaata
gactttagtgatatagagattgaaatgaaggggcttaaccatgatatatggctaactaga
ttcagatataagggggaggatacatataagtatatcgatgaatggattaaagaggatgca
gaaaagtactggagtgtttggagagaatatacaacaaatccatggaatttagatctatgt
ccagctgctattgatatgtatagaacttatggtcttctccctataggtgatactgttagg
ggtggtacatggaaatatcattgggatttaaaaacaaaacagtattggtatggacaatat
ggagaaccagactcagaaataggatgtgcaattagaatacaaattgttagaagaaatatt
gaggaaatggctaatatagcgttcaatatgtctacccctgtatcacagagaatatcactt
aaaccaagtggtgaggtaatagtatcacttatagactctatatacaatgacaaacatact
gaaagttatgaaataaacgtgccaagaattggctcagttaaagctcctatctatgtcaat
gttttaaataatggttcagtaccaggtataccagataatgtagcagttgaaactcatgtt
agagtagatggcaaaggaatacacccaatacaaacctcaggtttaccaagtaaagttttc
aagtatgcgatactacctagaataatgagacttgaatgggctttagaagcaaatcttaaa
ggtggacgagatacattagttgagtggcttatagtagatgtaaggacaaatagtatgaaa
caggtaaatgatgttatagatgcaatactttctatgccaggtaacgaggaaatagctaaa
cattttagctag

DBGET integrated database retrieval system