KEGG   Ignisphaera aggregans: Igag_0370Help
Entry
Igag_0370         CDS       T01307                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
iag  Ignisphaera aggregans
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:iag00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:iag00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(325555..326454,326456..327067)
Genome map
AA seq 503 aa AA seqDB search
MSQGPKISFIGAGSARWTSRILVDIFMNKDLHNAEIWLMDIDDRRLNIIDTLARRLVNEL
KLPIKVYATKDRRKAIKDADFVISTALPKGYTYYETMRDISEKYGYYRGINSVEWNMVAD
YHTIWGYYLFKLHLDIARDIEELAPNAWFFIVSNPVLELTTMIARETKVKVAGICHGFLG
FRAAIEVLAMRLSKQMLGKDITSYCAAHMPECYDYMAKVIDFSDIEIEMKGLNHDIWLTR
FRYKGEDTYKYIDEWIKEDAEKYWSVWREYTTNPWNLDLCPAAIDMYRTYGLLPIGDTVR
GGTWKYHWDLKTKQYWYGQYGEPDSEIGCAIRIQIVRRNIEEMANIAFNMSTPVSQRISL
KPSGEVIVSLIDSIYNDKHTESYEINVPRIGSVKAPIYVNVLNNGSVPGIPDNVAVETHV
RVDGKGIHPIQTSGLPSKVFKYAILPRIMRLEWALEANLKGGRDTLVEWLIVDVRTNSMK
QVNDVIDAILSMPGNEEIAKHFS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggtcctaaaatctcatttattggagcaggaagtgcacgttggacaagtaga
attttagttgatatattcatgaataaggatcttcataatgctgagatatggcttatggat
atagatgatagaagacttaatataatagatacccttgctagaaggcttgtaaacgaattg
aaattgcctataaaggtctatgcaactaaggatagaaggaaggctataaaagacgcagat
tttgtaatatctacagctttacccaagggatacacatattatgaaactatgagggatatt
tctgagaaatatggctattataggggtattaatagtgttgagtggaatatggttgcagat
tatcacaccatatggggctactacttatttaagcttcatctagatattgctagagatata
gaggagttagctccaaatgcatggttcttcatagtatcgaaccccgttttagagcttaca
acaatgattgctagagagactaaggtaaaagttgctggtatatgtcatggcttcttaggc
tttagagcagctattgaggttcttgcaatgaggttatctaaacagatgctagggaaagat
ataacttcctattgtgctgcacatatgccagagtgctatgattatatggctaaggtaata
gactttagtgatatagagattgaaatgaaggggcttaaccatgatatatggctaactaga
ttcagatataagggggaggatacatataagtatatcgatgaatggattaaagaggatgca
gaaaagtactggagtgtttggagagaatatacaacaaatccatggaatttagatctatgt
ccagctgctattgatatgtatagaacttatggtcttctccctataggtgatactgttagg
ggtggtacatggaaatatcattgggatttaaaaacaaaacagtattggtatggacaatat
ggagaaccagactcagaaataggatgtgcaattagaatacaaattgttagaagaaatatt
gaggaaatggctaatatagcgttcaatatgtctacccctgtatcacagagaatatcactt
aaaccaagtggtgaggtaatagtatcacttatagactctatatacaatgacaaacatact
gaaagttatgaaataaacgtgccaagaattggctcagttaaagctcctatctatgtcaat
gttttaaataatggttcagtaccaggtataccagataatgtagcagttgaaactcatgtt
agagtagatggcaaaggaatacacccaatacaaacctcaggtttaccaagtaaagttttc
aagtatgcgatactacctagaataatgagacttgaatgggctttagaagcaaatcttaaa
ggtggacgagatacattagttgagtggcttatagtagatgtaaggacaaatagtatgaaa
caggtaaatgatgttatagatgcaatactttctatgccaggtaacgaggaaatagctaaa
cattttagctag

DBGET integrated database retrieval system