KEGG   Ignisphaera aggregans: Igag_0370Help
Entry
Igag_0370         CDS       T01307                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
iag  Ignisphaera aggregans
Pathway
iag00052  Galactose metabolism
iag00561  Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Igag_0370
  Lipid metabolism
   00561 Glycerolipid metabolism
    Igag_0370
   00600 Sphingolipid metabolism
    Igag_0370
Enzymes [BR:iag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Igag_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADM27212
UniProt: E0SR63
Position
join(325555..326454,326456..327067)
Genome map
AA seq 503 aa AA seqDB search
MSQGPKISFIGAGSARWTSRILVDIFMNKDLHNAEIWLMDIDDRRLNIIDTLARRLVNEL
KLPIKVYATKDRRKAIKDADFVISTALPKGYTYYETMRDISEKYGYYRGINSVEWNMVAD
YHTIWGYYLFKLHLDIARDIEELAPNAWFFIVSNPVLELTTMIARETKVKVAGICHGFLG
FRAAIEVLAMRLSKQMLGKDITSYCAAHMPECYDYMAKVIDFSDIEIEMKGLNHDIWLTR
FRYKGEDTYKYIDEWIKEDAEKYWSVWREYTTNPWNLDLCPAAIDMYRTYGLLPIGDTVR
GGTWKYHWDLKTKQYWYGQYGEPDSEIGCAIRIQIVRRNIEEMANIAFNMSTPVSQRISL
KPSGEVIVSLIDSIYNDKHTESYEINVPRIGSVKAPIYVNVLNNGSVPGIPDNVAVETHV
RVDGKGIHPIQTSGLPSKVFKYAILPRIMRLEWALEANLKGGRDTLVEWLIVDVRTNSMK
QVNDVIDAILSMPGNEEIAKHFS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggtcctaaaatctcatttattggagcaggaagtgcacgttggacaagtaga
attttagttgatatattcatgaataaggatcttcataatgctgagatatggcttatggat
atagatgatagaagacttaatataatagatacccttgctagaaggcttgtaaacgaattg
aaattgcctataaaggtctatgcaactaaggatagaaggaaggctataaaagacgcagat
tttgtaatatctacagctttacccaagggatacacatattatgaaactatgagggatatt
tctgagaaatatggctattataggggtattaatagtgttgagtggaatatggttgcagat
tatcacaccatatggggctactacttatttaagcttcatctagatattgctagagatata
gaggagttagctccaaatgcatggttcttcatagtatcgaaccccgttttagagcttaca
acaatgattgctagagagactaaggtaaaagttgctggtatatgtcatggcttcttaggc
tttagagcagctattgaggttcttgcaatgaggttatctaaacagatgctagggaaagat
ataacttcctattgtgctgcacatatgccagagtgctatgattatatggctaaggtaata
gactttagtgatatagagattgaaatgaaggggcttaaccatgatatatggctaactaga
ttcagatataagggggaggatacatataagtatatcgatgaatggattaaagaggatgca
gaaaagtactggagtgtttggagagaatatacaacaaatccatggaatttagatctatgt
ccagctgctattgatatgtatagaacttatggtcttctccctataggtgatactgttagg
ggtggtacatggaaatatcattgggatttaaaaacaaaacagtattggtatggacaatat
ggagaaccagactcagaaataggatgtgcaattagaatacaaattgttagaagaaatatt
gaggaaatggctaatatagcgttcaatatgtctacccctgtatcacagagaatatcactt
aaaccaagtggtgaggtaatagtatcacttatagactctatatacaatgacaaacatact
gaaagttatgaaataaacgtgccaagaattggctcagttaaagctcctatctatgtcaat
gttttaaataatggttcagtaccaggtataccagataatgtagcagttgaaactcatgtt
agagtagatggcaaaggaatacacccaatacaaacctcaggtttaccaagtaaagttttc
aagtatgcgatactacctagaataatgagacttgaatgggctttagaagcaaatcttaaa
ggtggacgagatacattagttgagtggcttatagtagatgtaaggacaaatagtatgaaa
caggtaaatgatgttatagatgcaatactttctatgccaggtaacgaggaaatagctaaa
cattttagctag

DBGET integrated database retrieval system