KEGG   Ignisphaera aggregans: Igag_0412Help
Entry
Igag_0412         CDS       T01307                                 

Definition
cytidine kinase (EC:2.7.1.73 2.7.1.- 2.7.1.11)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
iag  Ignisphaera aggregans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Igag_0412
Enzymes [BR:iag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Igag_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369241..370167
Genome map
AA seq 308 aa AA seqDB search
MSKSYDVVAVGHALVDIRIVVDRFPGPDEEARVLDQTWGGGGSAVNMAIDAKRLGLRSSV
IAKIGFDSFGRIIVDELLREGVDISGLRISVGKTGFTIVVIDKNGSITMYGYKGVAEDLE
PGDIDLDIISNSRYVHIASLRIDTSIHVAEIARKNNSKVLWDPGRVLAGKGIDALSKLIE
KVDIVLLNNLEAKMLTNLDDHREAAKIIKSLGPELVIVKRGSKGVYALGYGLDEEIPAMN
IDRVVDTTGAGDAFAAGLIAGMIRGYTIKKAILYANAVAALKITKLGSHEAPTHEEVVNF
IWEKGLAI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagagctatgatgttgttgctgtagggcatgctctagtggatataaggattgtt
gttgatagatttccaggaccagatgaagaggcaagggtattggatcagacctggggtggt
ggaggatctgcagtaaatatggctatagatgctaagagattagggcttagatctagtgtt
atagcgaaaataggttttgattcttttggtaggataatagttgatgaactacttagagag
ggtgtagatatctctggtctaaggatatcagtaggaaagacaggatttacaatagtagtt
atagataagaatggctctataacaatgtatggatataaaggtgttgctgaggatttggag
cctggagatatagatctagatattatatcaaatagtagatatgttcatatagctagtctt
agaatagatacatctatacatgtagcagaaatagctaggaagaacaactctaaagttcta
tgggatccaggaagagttttagcgggtaaaggtatagatgctttaagcaaacttattgag
aaggtagatatagttcttctaaataacctagaagcaaaaatgcttacaaatctcgatgac
catagagaagctgcaaaaataataaagtctctaggtcctgaactagttatagtgaaaaga
ggttcaaaaggagtttatgcactaggttatggtttagatgaagagataccagctatgaat
atagatagagttgttgatacaactggtgctggagatgcatttgcagcaggtcttatagct
ggaatgataagaggatatacaataaagaaagcaatattatatgcaaatgctgtagcagct
ctaaagataactaaactaggatcacatgaagctccaacacatgaagaagttgttaatttt
atatgggagaaaggtctggctatatag

DBGET integrated database retrieval system