KEGG   Ignisphaera aggregans: Igag_0470Help
Entry
Igag_0470         CDS       T01307                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_0470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_0470
   00052 Galactose metabolism
    Igag_0470
   00500 Starch and sucrose metabolism
    Igag_0470
   00520 Amino sugar and nucleotide sugar metabolism
    Igag_0470
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Igag_0470
   00524 Butirosin and neomycin biosynthesis
    Igag_0470
Enzymes [BR:iag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Igag_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(420049..421074)
Genome map
AA seq 341 aa AA seqDB search
MFLGNQYVIGIDIGATWTRIALARVDGSIASRHVFRTPREGDRYTIANTIISSIRREFSN
YLDNVKAIGIGTIGPLDLTQGMVINSPNVAIRTFEVAKPILEEFKKPVVMANDCVTAVWG
EKYFGLGRGYSNIVYITISTGIGGGIIVDDTLLLGKMGNAHEIGHIVVDTSGKMECGCGG
KGHWEAYASGANIPRFAYRLIDEWNLTQNERESPVYRAYLNRELTSELIYTYAKKGDSLA
LRIINEVNKYNIAGFENVINSYDPEIITVGGSVALRNPELVVEPIVRGIENSKGVVTARP
RIDVTPLGDDIVLIGALALALYPPPNLVKKLRYLESISIDL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgggtaatcaatatgttataggaatagatataggtgctacatggacacgtata
gctttggctagagtagatggatctatagctagtagacatgtttttagaactcctagggag
ggtgatagatatacaattgcaaatactataatcagtagtataagaagggaattctcaaac
tatttagataatgttaaggctattggtattggaactataggtcctcttgatctaactcaa
ggtatggtcataaactctccaaatgtagctatacgtacatttgaagtagctaaacctatt
ttagaggaatttaaaaagcctgtagtaatggctaacgactgtgttactgctgtatggggt
gaaaaatattttggtcttggtagagggtatagcaatattgtttatataactataagtact
ggtataggaggtggtattattgttgatgatacactactcctaggaaagatgggaaatgct
catgagataggacatatagttgtagatactagtggaaaaatggaatgtgggtgtggagga
aagggtcattgggaagcatatgcaagtggtgcaaatataccgaggtttgcatatagactc
atagatgagtggaacttaacacaaaatgaaagagaatcaccagtatatagagcatacctc
aatagagaacttacatcagaacttatctatacatatgctaagaaaggtgatagcctagct
ctaaggattatcaatgaagttaataaatataatatagctggatttgaaaatgttataaat
tcctatgatccagagattataacagttggaggatctgttgctctaagaaatccagaactt
gttgtagagcccatagtaagaggtattgagaattcaaaaggtgttgtaacagctcgtcca
agaatagatgtaacaccacttggagatgatatagttctaataggagcattagcattagca
ctatatccaccaccaaatcttgtgaaaaaacttaggtatctcgaatctatatccatagat
ctataa

DBGET integrated database retrieval system