KEGG   Ignisphaera aggregans: Igag_0570Help
Entry
Igag_0570         CDS       T01307                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
iag  Ignisphaera aggregans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Igag_0570
Enzymes [BR:iag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Igag_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516507..517688
Genome map
AA seq 393 aa AA seqDB search
MYREKSCGSTIMDVYYRARGTEIYIERKGVEKPLYIFGINWAGFEWRGRVVGGLHVRNWV
EILQQIKSLGFNAIRIPFCAESVKPGVFPAPRTINYALNRDLIGLDSISIMEKIIAKAAE
LELYILLCFHNISCLIMEPLWYTPLFSEQQFIDTWIRVAKRFSRYWNVIGAELYNNPHGR
LPPSYYYESGECATWGMGNPKTDWNLAAERIGRAVLEVAPHWLIIVKGTQLTNPRSDNVP
LYPEATYWGENLRAVRDYPVNLPRDKLVYGVDIYGPDVYYMPYFNDPNIFPDKLYLIWDQ
NWGYVKKELGYPLIIAEFGGLYGRGDPRDVIWHQKLVEYMISNNICHWFYNALNPDNPST
AGLLENDWRTVREDKMALLRRAMDYCRERYGNI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagagaaaaatcctgtgggtcaactataatggatgtgtactacagggctaggggt
acagagatatatattgagaggaaaggtgttgaaaaacccctctatatctttggaataaat
tgggctggttttgagtggcgaggaagagttgttggtggtctccatgtcagaaactgggta
gagattctccagcagataaagagccttggtttcaacgctattagaataccattctgtgca
gaatctgttaagccaggtgtttttcctgctccaagaacaattaactatgcattgaataga
gatcttattgggcttgactccatatctattatggagaagataattgctaaagcagctgag
ctagagctatacatacttctatgcttccacaacataagctgtctaatcatggaaccacta
tggtatacacccctatttagcgaacaacagtttatagatacatggataagagttgcaaag
agatttagtagatattggaatgttataggtgcagaactatataataatccacatgggaga
ctcccaccatcttactactatgaaagtggagagtgtgctacatggggtatgggcaaccct
aagactgattggaatcttgctgcagagagaatagggagagctgttctagaggttgctcca
cactggctaataattgtaaaaggtacacagctaacaaatcccagatcagataatgtgcca
ctatatcccgaggctacctactggggtgagaatctcagagctgtaagagactatcctgtg
aatctaccgagggataagcttgtatatggtgtcgatatctatggacctgatgtatattat
atgccatatttcaatgacccaaatatatttccagataagctctatcttatatgggatcag
aattggggctatgtaaagaaggagcttggatatccactaattatagcagagtttggtgga
ctctatggaaggggtgatccaagggatgttatatggcatcaaaaacttgttgagtatatg
attagcaataatatttgtcactggttctacaatgctttaaatcctgataatcctagtaca
gctgggttgcttgagaatgattggagaactgttagagaggataagatggcactgcttagg
agggctatggattactgtagagagagatatggcaatatataa

DBGET integrated database retrieval system