KEGG   Ignisphaera aggregans: Igag_1026Help
Entry
Igag_1026         CDS       T01307                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Igag_1026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1026
  Lipid metabolism
   00071 Fatty acid degradation
    Igag_1026
  Amino acid metabolism
   00350 Tyrosine metabolism
    Igag_1026
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Igag_1026
   00626 Naphthalene degradation
    Igag_1026
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Igag_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969884..970936
Genome map
AA seq 350 aa AA seqDB search
MYMKAAVLWGNAEIDIGGERRYPDLPLKRDPLDIVDRDVPSIGSDQILVKVYACGVCYTD
IDIVEGRIKCKLPVVPGHQIIGRVVAIGDNVGDKIRIGDRVGIAWISWSCGKCYFCLSGQ
ENLCSDFKATGCHIDGGYEEYVAVYADYVYRIPDIFSDYEAAPLLCAGAVGYRALRLANM
RDGLKLGLFGFGSSAHIIIQIARKLYPSSEIYVFSRSEEHRELAKKLGADWTGKPSDNPP
KKIDRAIDFTPVGETIARALELLERGGRLVINVIRKQTMVNLDYTQHLWMEREIKSVANV
TRKDVIEFLEIASSIPVKPEIKLYRLDDVNQALRDLKAAKVKGSPVIAIS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgaaggccgctgtactttgggggaatgctgagatagatataggtggtgagaga
aggtaccctgatctacctttgaagagagatcctctagatattgttgatagagatgtccct
agtattggatctgatcaaattcttgtcaaggtctatgcatgcggtgtttgctataccgat
atagatatagttgagggtagaataaagtgtaagctacctgtagttccaggacatcaaatt
attggaagagttgttgccataggtgataatgttggtgataagattagaattggagataga
gttggtattgcatggatttcgtggagctgtggaaaatgctatttctgtttaagtggtcag
gaaaatctttgtagcgattttaaggcaacgggctgccatattgatggaggatacgaggag
tatgtagctgtctatgcagactatgtctataggataccagatatatttagtgattatgaa
gctgcaccacttctctgtgctggtgccgtgggatatagagctctaaggttagcaaatatg
agagacggtcttaagcttggcctcttcggattcgggtcatcagcccatataataattcag
attgcaagaaaactctatccatcatctgaaatctatgtatttagtagaagtgaggaacat
agagagcttgctaaaaaactaggtgctgattggactggaaaaccatctgataaccctcct
aaaaagattgatagagctatagactttacacccgtgggtgagactattgccagggcgttg
gaactacttgaaaggggtggaagactggttatcaatgttattagaaaacagactatggtt
aatctagactatacacagcatctgtggatggaaagagaaattaaaagtgtagctaatgtt
acaagaaaagatgttatagaatttctagagatagcatcctcaatacctgtgaaacctgag
ataaagctatatagactagatgatgttaatcaagcacttagagatctaaaggctgctaag
gtcaaaggatccccagtaattgcaatatcataa

DBGET integrated database retrieval system