KEGG   Ignisphaera aggregans: Igag_1134Help
Entry
Igag_1134         CDS       T01307                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_1134
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1134
   00020 Citrate cycle (TCA cycle)
    Igag_1134
   00620 Pyruvate metabolism
    Igag_1134
   00640 Propanoate metabolism
    Igag_1134
   00650 Butanoate metabolism
    Igag_1134
  Energy metabolism
   00680 Methane metabolism
    Igag_1134
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igag_1134
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igag_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053845..1054405
Genome map
AA seq 186 aa AA seqDB search
MSLKRIEIRWHGRGGQGAITASMILAEGAIYQGKYAQAYPEFGAERRGTPTRAYTRISDE
PIYSRAPIIHPDVVVVLDPTLDKSLYMGGLKSNGILVMNTKRSAKEVRDIIGREDIRIVR
VDATRIALEILKTPIVNMAMIGALLKSVPVVDMHYVEEAIKENFRPKVAEANILAMKRAF
EEAEII
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttaaaacgtattgagattcgttggcatggcagaggagggcagggtgctataacg
gcatcaatgatacttgctgagggtgctatatatcagggaaaatatgcacaggcctatcca
gaatttggtgcagagagaagaggaacaccaacaagggcatatacaaggatatctgatgaa
cctatatatagtagagcacctataattcatcctgatgttgtagtagttctagatcctact
ctagataaatcactctatatgggaggtttgaagagcaatggtattcttgttatgaatact
aagagaagtgcgaaggaggttagagatattatagggagagaagatattaggattgtacgt
gttgatgctactagaatagctttagagattctaaagacacctatagttaatatggctatg
attggtgccttactaaagagtgttccagttgttgatatgcattatgttgaggaagctata
aaggagaactttagacctaaggttgctgaagcaaatatattagctatgaagagagctttt
gaagaggctgagataatatga

DBGET integrated database retrieval system