KEGG   Ignisphaera aggregans: Igag_1134Help
Entry
Igag_1134         CDS       T01307                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_1134
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1134
   00020 Citrate cycle (TCA cycle)
    Igag_1134
   00620 Pyruvate metabolism
    Igag_1134
   00640 Propanoate metabolism
    Igag_1134
   00650 Butanoate metabolism
    Igag_1134
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igag_1134
   00680 Methane metabolism
    Igag_1134
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igag_1134
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igag_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053845..1054405
Genome map
AA seq 186 aa AA seqDB search
MSLKRIEIRWHGRGGQGAITASMILAEGAIYQGKYAQAYPEFGAERRGTPTRAYTRISDE
PIYSRAPIIHPDVVVVLDPTLDKSLYMGGLKSNGILVMNTKRSAKEVRDIIGREDIRIVR
VDATRIALEILKTPIVNMAMIGALLKSVPVVDMHYVEEAIKENFRPKVAEANILAMKRAF
EEAEII
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttaaaacgtattgagattcgttggcatggcagaggagggcagggtgctataacg
gcatcaatgatacttgctgagggtgctatatatcagggaaaatatgcacaggcctatcca
gaatttggtgcagagagaagaggaacaccaacaagggcatatacaaggatatctgatgaa
cctatatatagtagagcacctataattcatcctgatgttgtagtagttctagatcctact
ctagataaatcactctatatgggaggtttgaagagcaatggtattcttgttatgaatact
aagagaagtgcgaaggaggttagagatattatagggagagaagatattaggattgtacgt
gttgatgctactagaatagctttagagattctaaagacacctatagttaatatggctatg
attggtgccttactaaagagtgttccagttgttgatatgcattatgttgaggaagctata
aaggagaactttagacctaaggttgctgaagcaaatatattagctatgaagagagctttt
gaagaggctgagataatatga

DBGET integrated database retrieval system