KEGG   Ignisphaera aggregans: Igag_1135Help
Entry
Igag_1135         CDS       T01307                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
iag  Ignisphaera aggregans
Pathway
iag00010  Glycolysis / Gluconeogenesis
iag00020  Citrate cycle (TCA cycle)
iag00620  Pyruvate metabolism
iag00640  Propanoate metabolism
iag00650  Butanoate metabolism
iag00680  Methane metabolism
iag00720  Carbon fixation pathways in prokaryotes
iag01100  Metabolic pathways
iag01120  Microbial metabolism in diverse environments
iag01130  Biosynthesis of antibiotics
iag01200  Carbon metabolism
Module
iag_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1135
   00020 Citrate cycle (TCA cycle)
    Igag_1135
   00620 Pyruvate metabolism
    Igag_1135
   00640 Propanoate metabolism
    Igag_1135
   00650 Butanoate metabolism
    Igag_1135
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igag_1135
   00680 Methane metabolism
    Igag_1135
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igag_1135
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igag_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_10 Fer4_7 Fer4_6 Fer4_9 Fer4_16 Fer4_2 Fer4_8 Fer4_13 Fer4_15 Fer4_17 Fer4_4 Fer4_3 Fer4_22 Peptidase_M15
Motif
Other DBs
NCBI-ProteinID: ADM27947
UniProt: E0SP01
Position
1054402..1054725
Genome map
AA seq 107 aa AA seqDB search
MSEKRLPGYKSLPIGAAILRPGNYVERPTGDWRTFRPIINQDKCIRCLICWIVCPEPAIS
IADKPYKDSRGREWKFTLEIDYNYCKGCGLCVEECPVKAIDFVEEVK
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaagattacctggatataaatctcttccaataggagctgcaattctgaga
cctggtaactatgtagagagacctacaggtgattggaggacatttagacctattataaat
caggataagtgtataagatgtttaatatgctggattgtctgtcctgagcctgcaataagt
attgctgataaaccttataaggattctaggggtagggagtggaagtttactttggagata
gactataactattgtaagggatgtggactttgtgtagaggaatgccctgttaaagctata
gactttgttgaggaggtgaagtag

DBGET integrated database retrieval system