KEGG   Ignisphaera aggregans: Igag_1137Help
Entry
Igag_1137         CDS       T01307                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_1137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1137
   00020 Citrate cycle (TCA cycle)
    Igag_1137
   00620 Pyruvate metabolism
    Igag_1137
   00640 Propanoate metabolism
    Igag_1137
   00650 Butanoate metabolism
    Igag_1137
  Energy metabolism
   00680 Methane metabolism
    Igag_1137
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igag_1137
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igag_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055919..1056878
Genome map
AA seq 319 aa AA seqDB search
MSSSPQLYRTVFDIPREELFAPGHGLCAGCIAGTIAKLLLKATGPNTIVVTPTGCLEVST
SMYPYTSWRVPWIHVAFENAAAAASGIEAAIKALQRKGVLDPSKRINVVVIGGDGGTVDI
GLQALSGMLERGHRVLYVLYDNEAYMNTGIQRSGATPIKAWTTTTPVGKVLRGKLQPKKP
IAEIVAAHRIPYVATANPAYYIDMMNKFKKGLMVEGPSFVHVIQPCTTGWRFDPRYGIKI
ARLATETAMWINWELENNEVFRVTVPVPKRKHVRHYIRTQGRFNHLTDEDIEEIQKYIDK
EVERINKMVGKEVIGPVVE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagctcctctccacaactatatagaacagtatttgatatacctagagaagaactattt
gcaccaggacacggactctgtgcaggctgtattgcaggaacaatagcgaagttgttgtta
aaggctacaggtcctaatactatagtagttacgcctacaggatgtctagaagtatcaaca
tctatgtatccatatacatcatggagagttccatggatacatgtagcatttgagaatgcc
gctgctgctgctagtggtattgaggcagctataaaagctttacaaaggaaaggtgtatta
gatcctagtaagaggataaatgttgttgttataggtggtgatggaggtactgttgatata
ggtctgcaagctcttagcggtatgcttgagagaggtcatagagttctatacgtactctac
gataatgaggcatatatgaatacaggtattcagaggagtggtgctactccaataaaggca
tggacaactacaaccccagtaggtaaggtattgaggggtaagcttcagcctaagaaacca
atagcagaaattgtagctgcccatagaataccatatgtcgctacagcaaatcccgcatac
tatatagatatgatgaataagtttaagaagggtcttatggtagagggtccatcatttgtc
catgtaatacaaccatgtacaacaggctggagatttgatcctagatatggtattaagata
gcaagacttgctacagagactgctatgtggataaactgggaacttgaaaataatgaggta
tttagagttacagtacctgttccaaagaggaaacatgtaagacactatataagaacacaa
ggaagatttaaccacctaacagatgaggatatagaggaaatacagaagtatatagataaa
gaagttgagcgaataaataaaatggttggaaaagaagtcataggtcctgtagttgagtaa

DBGET integrated database retrieval system