KEGG   Ignisphaera aggregans: Igag_1137Help
Entry
Igag_1137         CDS       T01307                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Igag_1137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1137
   00020 Citrate cycle (TCA cycle)
    Igag_1137
   00620 Pyruvate metabolism
    Igag_1137
   00640 Propanoate metabolism
    Igag_1137
   00650 Butanoate metabolism
    Igag_1137
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Igag_1137
   00680 Methane metabolism
    Igag_1137
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Igag_1137
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Igag_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055919..1056878
Genome map
AA seq 319 aa AA seqDB search
MSSSPQLYRTVFDIPREELFAPGHGLCAGCIAGTIAKLLLKATGPNTIVVTPTGCLEVST
SMYPYTSWRVPWIHVAFENAAAAASGIEAAIKALQRKGVLDPSKRINVVVIGGDGGTVDI
GLQALSGMLERGHRVLYVLYDNEAYMNTGIQRSGATPIKAWTTTTPVGKVLRGKLQPKKP
IAEIVAAHRIPYVATANPAYYIDMMNKFKKGLMVEGPSFVHVIQPCTTGWRFDPRYGIKI
ARLATETAMWINWELENNEVFRVTVPVPKRKHVRHYIRTQGRFNHLTDEDIEEIQKYIDK
EVERINKMVGKEVIGPVVE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagctcctctccacaactatatagaacagtatttgatatacctagagaagaactattt
gcaccaggacacggactctgtgcaggctgtattgcaggaacaatagcgaagttgttgtta
aaggctacaggtcctaatactatagtagttacgcctacaggatgtctagaagtatcaaca
tctatgtatccatatacatcatggagagttccatggatacatgtagcatttgagaatgcc
gctgctgctgctagtggtattgaggcagctataaaagctttacaaaggaaaggtgtatta
gatcctagtaagaggataaatgttgttgttataggtggtgatggaggtactgttgatata
ggtctgcaagctcttagcggtatgcttgagagaggtcatagagttctatacgtactctac
gataatgaggcatatatgaatacaggtattcagaggagtggtgctactccaataaaggca
tggacaactacaaccccagtaggtaaggtattgaggggtaagcttcagcctaagaaacca
atagcagaaattgtagctgcccatagaataccatatgtcgctacagcaaatcccgcatac
tatatagatatgatgaataagtttaagaagggtcttatggtagagggtccatcatttgtc
catgtaatacaaccatgtacaacaggctggagatttgatcctagatatggtattaagata
gcaagacttgctacagagactgctatgtggataaactgggaacttgaaaataatgaggta
tttagagttacagtacctgttccaaagaggaaacatgtaagacactatataagaacacaa
ggaagatttaaccacctaacagatgaggatatagaggaaatacagaagtatatagataaa
gaagttgagcgaataaataaaatggttggaaaagaagtcataggtcctgtagttgagtaa

DBGET integrated database retrieval system