KEGG   Ignisphaera aggregans: Igag_1229Help
Entry
Igag_1229         CDS       T01307                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1229
   00030 Pentose phosphate pathway
    Igag_1229
   00051 Fructose and mannose metabolism
    Igag_1229
   00052 Galactose metabolism
    Igag_1229
   00500 Starch and sucrose metabolism
    Igag_1229
   00520 Amino sugar and nucleotide sugar metabolism
    Igag_1229
  Nucleotide metabolism
   00230 Purine metabolism
    Igag_1229
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Igag_1229
Enzymes [BR:iag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Igag_1229
    5.4.2.8  phosphomannomutase
     Igag_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1151969..1153348)
Genome map
AA seq 459 aa AA seqDB search
MNMERKLFGTDGVRWIVDKESLDFVLRLAMAIGSYFPKGSRALVGMDGRLGNSAIYGTVL
SALSASGSKVYDAGLLPTPALQYCVKEFGFDYGVMVTASHNPPEWVGIKLILSDGIEAPP
NVDVEVESILFESKFRRVQWYEVRSIEKFEGAIGYYIDAIKKHVDVEKIRKKQIKVVVDC
ANSVSALTTPRTLKELGLKVLSINSDIGIPYRPYEPTPENLYELMSIVKAVGADFGVAHD
GDGDRAVFIDNLGRFIPGDISAIILSWYVELKRPELPKRIVTAISTSHFLVEENLIKRGI
EVVWTRVGFLNIARKIIELGGALSGFEDNGGFAYVPHQLIRDGTMTAALMAEYLASIDTS
LASVVDSIKKPIVLREKLPIQSREEGKKIIEGIKEIYRGNRYIDIDGIKVISHNFAFLVR
PSGTEPLIRITVESWDRNIAEKTLNELITYIKSIQGKNQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggagagaaagctatttggaacggatggagttagatggatagtagataaggaa
agtctagatttcgtattaagattggcaatggctataggaagctattttccaaagggctct
agagcacttgttggtatggatggtaggcttggaaattcagcaatatatggaactgttcta
agtgccctctctgcttcagggtcgaaagtttatgatgcaggcttactacctactccagca
ttacaatactgtgtaaaagagtttggatttgactatggtgttatggtaacggcaagccat
aatccaccagaatgggtaggtataaaattgatattaagtgatggtatagaagctccacca
aatgttgatgtagaggtagaatcaatattatttgagtctaaattcaggagagttcaatgg
tatgaagtgagatcgatagaaaaatttgaaggtgctataggatattatattgatgcaata
aagaaacatgtagatgtagagaaaattaggaagaagcaaataaaagttgttgtagattgt
gctaatagtgtttcagcacttacaacacccagaactttaaaagagcttgggctaaaggta
ttgtctataaattccgatataggtattccatatagaccctatgaacctacacctgaaaac
ttatatgaattaatgagtattgtaaaggcagttggtgcagattttggtgttgcacatgat
ggtgatggtgatagagcagtatttattgataatctaggtagatttatccctggggatatt
tcagcaataatactttcatggtatgtcgaattaaagagaccagaacttccaaagcgaata
gtaactgctatttcaacaagtcacttccttgttgaggaaaatttgattaagagaggaatc
gaagttgtgtggacaagggtaggatttttaaacatagctagaaagataattgagcttgga
ggagctctctcaggttttgaggataatggaggttttgcatatgtaccccatcaactaatt
agagatgggactatgactgccgccttaatggcagaatatttagcctctatagatactagt
ttagcttctgttgtagactctataaagaaacctatagtattgagggagaagctaccaata
caaagtagagaggaaggtaagaagattatagaaggtattaaggagatatatagaggcaat
agatatatagatatagatgggataaaggtcatatcacacaattttgcatttcttgtaagg
ccaagtggaactgaacccttgataaggataactgtagagtcgtgggatagaaatatagca
gaaaaaacattaaatgaattaataacttacatcaaatctatccaaggtaaaaatcaatga

DBGET integrated database retrieval system