KEGG   Ignisphaera aggregans: Igag_1381Help
Entry
Igag_1381         CDS       T01307                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
iag  Ignisphaera aggregans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Igag_1381
Enzymes [BR:iag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Igag_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293190..1294125
Genome map
AA seq 311 aa AA seqDB search
MAEAGLYISPLEDYSAFLGFNRDRKKTPFTIIGIPLDISSSYRSGCSLAPQSIRNTSRSI
ELCSFVNNINLEDIGFEDLGNIIMAPGDIITSLKRIEIVIESLLNEGRRIFILGGEHTLT
YGSFKAFAKIFKNPCLLVFDAHLDLRDEYLGTKFNHATVIRRIIDDTNVLKVIFIGSRAI
SMEESSYALEKNDKVSIYRFWGSRIPIDIIDRVREDISRCDAIYISIDMDVIDPAYAPGV
QTPEPLGIDPQNLLQILSRLIDTRTWVTDIVEITPVYDHSETTSFLASRIIIEIASILIE
SLNIEKSYCKI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcaggtttgtatataagtcctctagaagattattctgcatttctaggattt
aatagggatagaaagaaaacaccatttacaatcattggaataccactagatatatcatcg
agctatagaagtggatgtagtttagctcctcaaagtataagaaatacatctagatctata
gagctatgttcatttgtaaacaatattaatctagaggatatagggtttgaagatcttgga
aatataattatggcaccaggagatattattacatcactaaagcgtatagaaattgttata
gaatcgctacttaatgaaggaagaagaatattcatattagggggagaacatacattaaca
tatggttcatttaaggcatttgcaaagattttcaagaatccatgtctattagtatttgat
gcacacctagatctaagagatgagtatctaggtacaaagttcaatcatgctacagttata
agaagaatcatagatgatacaaatgtacttaaagtaatatttatcgggtcaagagccata
agtatggaggaaagtagttatgcattagagaagaatgacaaagtctctatctacagattt
tgggggagtagaatacctattgatataatagatagagttagggaggatatatcaagatgt
gatgctatatatatatcaatagatatggatgttatagaccctgcatatgcaccaggggtt
caaacaccagaaccccttggaatagacccacaaaatcttttgcaaattctaagtaggtta
atagatacaagaacatgggttaccgatatagtagaaataacacctgtatatgatcatagt
gagaccacatcctttctcgcctcacgaattataattgagatagcatcaatattaatagaa
agtcttaacatagagaaaagctattgtaaaatctga

DBGET integrated database retrieval system