KEGG   Ignisphaera aggregans: Igag_1400Help
Entry
Igag_1400         CDS       T01307                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
iag  Ignisphaera aggregans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Igag_1400
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Igag_1400
Enzymes [BR:iag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Igag_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306530..1307465
Genome map
AA seq 311 aa AA seqDB search
MRHKSFYRRDIISILDFTREDLEQLFEYADKFIEYGDKKFSVLSNKVITLAFFEPSTRTR
LSFEIASKKLGADVITIVGEEAVSIAKGENFTDTIRMLDTFSNAIVLRHRFEGAAKYAAE
IAENPVINAGDGRQHHPTQTMIDLYTIKKLFGTIDGLTYGVLGDLRYGRAAASFIYGLTL
FNPKKIYLISPPLLRAREEIIKVLNDKGINFEETTNIEDVLPYLDVLYVIRIQKERFPDP
MEYERVRGSYRVTLDLLSKGRKELKVLHPLPKVDEIDHDVDSSPYAAYFIQARFGIPVRM
ALLALLFGVEI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgagacataaatctttttatcgtagagatataatatcgatacttgattttacacgtgag
gatttagaacagttgtttgaatatgcagataagtttattgaatacggagataagaagttc
tcggtgttaagcaataaggttataaccctagcattctttgaaccatcaacacgaacaagg
ctcagctttgaaattgctagtaaaaagctaggtgcagatgttattacaattgttggagaa
gaagcagtaagtatagcaaaaggtgaaaactttactgataccataagaatgcttgataca
ttttctaatgcaatagtacttagacataggtttgagggagcagctaaatatgcagcagaa
atagctgaaaaccctgttataaatgctggtgatggtagacaacatcaccccactcaaacg
atgatagatctatacactattaaaaaactatttggaactatagatggacttacctatggt
gttttaggggatcttaggtatggtagagcagctgcatcgtttatatatggtttaactctc
ttcaatccaaagaaaatataccttatatcaccaccacttcttagagctagagaggagata
ataaaggtattaaacgataaaggtattaatttcgaggaaacaacaaatattgaggatgta
ttgccctatctcgatgttctctacgttattcgcatccaaaaagaacgtttcccagatccc
atggaatatgaaagagtaagaggctcctatagagtaacgttagatctattatctaagggt
agaaaagaacttaaggtactacacccattgccaaaggtcgatgagatagaccatgatgta
gattcttctccctatgcagcatattttattcaggctaggtttggtataccagttagaatg
gctcttttagcattgttatttggtgttgagatatga

DBGET integrated database retrieval system