KEGG   Ignisphaera aggregans: Igag_1482Help
Entry
Igag_1482         CDS       T01307                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
iag  Ignisphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:iag01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:iag01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:iag00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1377374..1379341
Genome map
AA seq 655 aa AA seqDB search
MYYRVLRINVENGNWYIKEYDGNEIIGPVDLGIHIHEELKTWEKDVFDPSNAVIIGTGLF
AGSKLFGTHRLVVVFRSPESRTLHVAAMGGAAYRFIGCGVHAIVIEGRSSKPSIIFVKGN
ENGVEHVKIEYIDPEELEKIYSGYGEYIGAYALQKYLMDKYWDYIYSTKARPLVVGPAAL
KTVYGAIVSIDIDFNKKSFIIGSEDFAARGGAGSVLAQAHNVVAIIAGGNWKPQLPKDLI
ESIALNELFKRIAGKDFVSLVNEATVKYRYDPNIGAGGTFGVNYPHYRELLPLFNFNTMY
LPKHIRKKIIDILLENFWKPFKEETYAKGKWTMTTCGEPCPAACKKIWRGKKLDYEPTNG
LGPYIGVLELDKTAKLVDLADQLGYDAIVAGHLVAWLFEAVYKGLLDPSDIGLNDRPIMD
PMIMNIEILSKNAELAEILLKNIVNHSTEVLKIIATKGIRMAAKYLDEKYMDRIKKIGVK
FEDLVVYLPYGDQGYMTPNFYWTPGFLLPLAVTGKYWTNYTSTFTEPEEFAKTVAIRAIK
EYEIENAGLCRFHRGWAEKNLSQLYSLIGINIDIDKHAKSMYQKIALYSIKAGAKPRFLE
SEKAKDVILTLSVEFNVSEWMGKYIKDREATIREWWSRAGKAFAQQMELSQDWIE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgtactatagagtgcttagaatcaatgtggagaatggaaattggtatataaaggaatat
gatggaaatgagataataggacctgtagatctagggatacatattcatgaagaattaaaa
acatgggagaaagatgtctttgatccaagtaacgctgtaattattggaacagggcttttt
gcaggtagcaagctctttggcacccatagacttgtggttgtgtttaggagtcctgaaagt
agaactctacatgttgctgctatgggtggagcagcatataggttcattgggtgtggagtt
catgcaattgttatcgagggaagaagctcaaagccttcaataatatttgtaaaaggtaac
gaaaatggtgtagaacatgttaagatagaatatatagatcctgaagaattagagaagata
tatagtggatatggagaatatataggtgcatatgcattacagaagtacttaatggataaa
tattgggattatatctattctacaaaggcaagacctcttgtagtaggtcctgcagcacta
aagacagtatatggtgcaatagtttcaatagacatagacttcaacaagaagtcatttatt
attggtagtgaagattttgctgcacgaggaggagcaggttcggtattggcacaagcacat
aatgttgtagctataatagctggaggcaactggaagccacagctacctaaggatttaata
gagagtatagcattaaatgaactgtttaagagaattgcaggaaaagactttgtatcatta
gtaaatgaagcaacagtgaaatatagatatgatccaaatataggtgctggtggaaccttt
ggcgtaaactatcctcattatagagagttgttaccactattcaatttcaatacaatgtat
ttgcccaagcacataaggaagaaaattattgacatacttcttgagaacttctggaaacca
ttcaaagaggaaacctatgcaaaaggaaaatggactatgacaacatgtggtgagccctgt
cctgcagcatgcaagaagatatggagaggtaaaaaacttgattatgaaccaacaaatgga
cttggaccatatataggtgtactagaacttgataaaactgctaaattggttgatctagct
gatcaactaggatatgatgcaatagtggcaggtcatttagtagcatggctatttgaagca
gtttataaaggtcttctagaccctagtgatataggtttaaatgatagacctattatggat
ccaatgataatgaatatagaaatactgtcgaagaatgctgaactagctgaaattctactt
aagaatattgttaatcattctacagaggtactaaagattatagctacaaaaggcataaga
atggcagctaaatatcttgatgagaagtatatggataggattaagaagattggagtgaaa
tttgaagatttagtagtatatctaccctatggagatcaaggatatatgaccccaaacttc
tattggacaccaggatttctattaccattagcagtaacaggcaagtattggacaaactat
acatccacatttactgaacctgaagagtttgctaaaacagttgcaataagagctataaaa
gaatacgaaattgaaaatgcaggtctttgtagattccataggggctgggcagagaagaat
ctcagtcaattgtatagcttaattggtataaatattgatattgataaacatgctaaatcg
atgtatcagaaaattgcgttatatagtataaaggctggagcaaagccaaggttcttagaa
agtgaaaaagcaaaggacgtaatactaaccctttctgtagaattcaatgtatctgaatgg
atgggtaaatatataaaggatagagaagcaacaataagagaatggtggagtagagcaggt
aaagcatttgcacaacagatggaattgtctcaagattggatagagtaa

DBGET integrated database retrieval system