KEGG   Ignisphaera aggregans: Igag_1574Help
Entry
Igag_1574         CDS       T01307                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
iag  Ignisphaera aggregans
Pathway
iag00340  Histidine metabolism
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Igag_1574
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Igag_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FAM25
Motif
Other DBs
NCBI-ProteinID: ADM28376
UniProt: E0SRC2
Position
complement(1456293..1457495)
Genome map
AA seq 400 aa AA seqDB search
MTVIRGLPERRSIGLVDVLDRVREIIEHVKIYGDKALIELTKKFDGVDIEKISLDREELE
SISRELDERTMNAIDEIYGFLEEFYRSIKPFDHIVTVNGVRLGIVWRGIDRVGIYVPGGA
RGYPSTLLMAGIPARVAGVREIYVATPPLRNGSISPAIAYIAMKMGVERVYRIGGAHAIA
AMAYGTESIVKVDKIVGPGNIYVQAAKFLVQDVVAIDGIEGPTELIVVADEYADPEKIAF
DMMAQAEHGIHTFIVLLTTSSIVADRVSAILDRDYVHRYYIDVVGSIDEAIEIVNRVAPE
HLALHVRNWERYIDRIRNVGAISIDDIPPALIDYIGPNHILPTEGWARSRGCLTIYDFLK
PVSVLFEVEVVPRSLIEAVKILAEYEGFVIHSKSVGVRYG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactgttataagaggtttgcccgagagaagatctattgggcttgtagatgttttggat
agggttagagagattatagagcatgtgaagatatatggagataaagcattgatagaactt
acaaagaagtttgatggagttgacatagagaagatatcgctagatagagaagagcttgag
tcaatatctagggaattagatgagagaactatgaacgcaatagatgagatctatggattt
ctagaagagttctatagatctattaagccctttgaccatatagttacagtgaatggtgtt
agacttggaatagtttggaggggtattgatagagttggtatatatgttcctggaggtgct
aggggttatccatcaactcttttaatggctggtatacctgcgagggttgctggggttaga
gagatatatgtagctacacccccgctaagaaatggttctataagtcctgctatagcgtat
atagctatgaagatgggtgtagagagagtttatcgtattggtggtgcacatgctattgct
gctatggcttatggtacagagagcattgttaaggtggataaaattgttggtcctgggaat
atctatgtacaagcagcaaagtttttggttcaagatgttgttgctatagatggtatagaa
ggacctacagaacttattgttgttgcagatgaatatgctgatccagagaaaatagctttt
gatatgatggcacaagcggaacatggaatccatacgttcatagttcttctaacaacatcg
agtattgttgcagatagggtttcagctatactcgatagagattatgttcacagatattac
atcgatgttgttggaagtattgatgaagctatagagattgtgaacagggttgcaccagag
catctagctctccatgtaaggaattgggagagatatatagataggattagaaatgtaggt
gctatatctattgacgatattcctccagctttaatagattatataggtcctaaccatata
ctgcctacagaggggtgggctagatctagaggatgtctaactatctatgacttcctaaaa
ccagtttcagtactatttgaagtagaggttgtgcctaggagtctcatcgaagctgtaaag
attcttgctgaatatgagggttttgttattcatagcaaaagtgtgggtgttagatatggc
tag

DBGET integrated database retrieval system