KEGG   Ignisphaera aggregans: Igag_1585Help
Entry
Igag_1585         CDS       T01307                                 

Definition
(GenBank) branched-chain acyl-CoA synthetase (ADP-forming) alpha subunit; acetyl-CoA synthetase (ADP-forming) alpha subunit
  KO
K01905  acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13]
Organism
iag  Ignisphaera aggregans
Pathway
iag00010  Glycolysis / Gluconeogenesis
iag00620  Pyruvate metabolism
iag00640  Propanoate metabolism
iag01100  Metabolic pathways
iag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Igag_1585
   00620 Pyruvate metabolism
    Igag_1585
   00640 Propanoate metabolism
    Igag_1585
Enzymes [BR:iag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Igag_1585
Lipid biosynthesis proteins [BR:iag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Igag_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Succ_CoA_lig CoA_binding_2 CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADM28387
UniProt: E0SRD3
Position
1466549..1467940
Genome map
AA seq 463 aa AA seqDB search
MTDLKYLFYPRGIAVVGASRDPNKIGSIILKNLIEYGYQGRIYPINPYANELMGLRAYPS
ISSVEGPVDVAVVSVPAKNVLDVIDDAGKAGVKFAVVISSGFKEVGNVELEEELVRRAHK
YGIRVLGPNIFGYVYTPSRINASFGPRDVIPGNVAFISQSGALGIALMGTTILENIGVSS
IVSIGNKADLEDADFLEFFENDPNTSVILLYIEGVRDGRRFIEIAGRVSLKKPIIAIKSG
RTEAGAKAAASHTGSLAGGPVIWETALKQAGILFAKTVEDAFDWVKALSWNPIPAGDMLV
VITNGGGAGVQATDTLAENGIILTRSPKDLVEEIKRFAPPFASLANPIDITGMAPDEWYY
KALLAALKNPDVHAIVVLYCQTAVTNPMGVAKSILDAVKDSGIKKPITVGMVGGVETFEA
IKYLTKNNIPAYPTPERAAAAMASIYRYLKLRDYVAKRLEVRY
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacagatctcaaatatttgttctaccctagaggtatagcagttgtaggagcatctaga
gatccaaataaaatagggagtataatattaaagaacttgatagaatatggttatcaaggc
agaatatatccaattaatccttatgcaaatgagttaatggggcttagagcctatccatcg
atttcctcagtagagggccccgtagatgttgctgtagtctctgtacctgctaagaatgta
ttagatgtaatcgatgacgcgggtaaagccggggtaaagtttgctgtagtaatatcatct
ggatttaaagaggtgggaaatgtagaacttgaagaggaacttgttagaagagctcataaa
tatggtataagggtcttaggccctaacatcttcggatatgtctataccccatctagaata
aatgcatcgtttggtcctcgcgatgttatacctgggaatgtagcatttatatcgcaaagc
ggtgccctaggaatagctctcatgggtacaacaatacttgaaaatataggtgtttcatca
atagtaagcatagggaataaagctgatcttgaagatgcagacttcctagagttttttgaa
aatgatcctaatacctcagtcatattattatatattgagggtgttagagacgggaggaga
tttatagagattgccggtagagtaagtctgaagaaaccaataatagcgataaagtcgggt
agaaccgaggcaggtgccaaagcagctgcaagccataccggctccctcgctggagggcct
gtgatatgggagacagccctcaaacaggcaggcatactattcgctaaaactgttgaggat
gcattcgactgggttaaagccctctcatggaatcctataccagctggcgatatgcttgtt
gtgataactaatggaggtggtgcaggagttcaggcaacagataccctagctgaaaacgga
attattctaacgagatcacccaaagatcttgttgaagagataaagagatttgcacctcca
tttgcatcactagcaaatcccatagatataacgggtatggctcctgatgaatggtactat
aaagctctattagcagctttaaagaatccagatgtgcatgccatagttgttctctactgt
caaacagcagtaacaaatcccatgggagtagctaaatcaatattagatgctgttaaagac
tctggtatcaagaaaccaataactgttggtatggttggtggtgttgaaacttttgaagca
attaaatacttgactaagaataacatacctgcatatccaacacctgaaagagcagctgca
gccatggcctctatatatagatatctcaagctgagagactatgttgcaaagcgattagaa
gtcagatactga

DBGET integrated database retrieval system