KEGG   Ignisphaera aggregans: Igag_1635Help
Entry
Igag_1635         CDS       T01307                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
iag  Ignisphaera aggregans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Igag_1635
Enzymes [BR:iag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Igag_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520319..1521272)
Genome map
AA seq 317 aa AA seqDB search
MYIFLNIYVAGRINIDTIIEIEGHISPGMKYTGKLVLEDLGGTATNIATAIKRYDRRHRV
FILGSIGKDYKDYIFRLLESEGIECSYISITDSYTGRAYIFINSSRESTIVTLSGANDLY
SLDKLGEIHSDSIIVIANTQRTTALKLINIANDMDLKLFLDPGKSWMRKEDLRLIKTECF
FLPNIDEFRYLFNRDIDDIQDIDTGRCIPIVKMGSRGSMAINWLEGYIVELSSIPIERIG
LKPMSTAGCGDTFTGVFIASYIETNNIIESLKRAIVAASIKMSRISSRDSPYRDEIERIL
QRVEQENLLRITIRNLR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatcttcttgaatatttatgtagctggaagaattaatatagatacaattatagag
atagaggggcatatctctccagggatgaagtatactggaaagcttgtacttgaagatctt
gggggaacagctacaaatatagcaacagcgataaagagatatgatagaaggcatagagtc
tttatactaggttctatagggaaggactataaggactatatatttagattgctagaatct
gaagggatagaatgctcatatatatcaataactgatagctatacaggcagagcatatata
ttcatcaacagctctagagaatcaacaatagtgacactatctggagcaaatgatctctat
agcttagataagcttggtgaaatacatagcgattccattatagttatagcaaatacacag
agaaccacagctttaaagcttattaatattgctaatgatatggatttgaaactcttttta
gatcctgggaagagctggatgaggaaagaggatcttagattgataaaaactgaatgtttc
tttcttccaaatatagatgaatttagatatctattcaatagagatatagatgacatacaa
gatattgatacaggtagatgtatccctatagtaaagatgggttcaagaggttcaatggca
ataaactggttagagggctatatagtagaactatcatcaataccaatagaacgaataggt
ctaaaacctatgtcaacagctggatgtggagatacctttacaggagtctttatagcttcc
tatatagagacaaataacattattgaatcgttaaagagagctatagttgctgcatcaata
aaaatgtccagaatatcatctagagattcaccatatagagacgaaattgagagaattcta
cagagagttgaacaggaaaatcttcttagaattactattagaaatcttagatag

DBGET integrated database retrieval system