KEGG   Ignisphaera aggregans: Igag_1712Help
Entry
Igag_1712         CDS       T01307                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
iag  Ignisphaera aggregans
Pathway
iag00260  Glycine, serine and threonine metabolism
iag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01130  Biosynthesis of antibiotics
iag01230  Biosynthesis of amino acids
Module
iag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1712
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igag_1712
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Igag_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADM28509
UniProt: E0SS52
Position
complement(1591528..1592886)
Genome map
AA seq 452 aa AA seqDB search
MEIKHLRSPQTEDILPDHWYNIVPDLPEPLPPMKKPNGEDVKPEELIAIFPKKLIEQEFS
TERFIKIPDELLSLYLELGRPTPLFRARRLEEFLDTPARIYYKYEGVLPTGSHKINTAIA
QAYFNMLEGTKRLTTETGAGQWGSALALAGALFGLKVRVYMVRASYDQKPYRRILMQIYG
AEVIPSPSPYTKSGREILERDPNHPGSLGIAISEAIEDAVTNPGTKYSLGSVLNHVLLHQ
TIIGLEAIKQFELIGEELPDIVIGCVGGGSNFAGLAYPFYYEEIVRGKKKSVKIIAVEPK
AVPSMTRGIYTYDYGDTARLTPMLKMYTVGHRYTPPPIHAGGLRYHGVAPTLALLVKNNI
VKPVAYHQTEVFRAAQLFAQMEGIVPAPESAHAVKAVIDEAIRAREEREKKVIIFNLSGH
GLLDLAGYQEYLENRLRDYEPEKIDLSYLNTY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggagataaagcatcttagatctccacaaacagaagatatactacctgatcactggtat
aacatagttcctgatctaccagaaccattaccaccaatgaaaaaaccaaatggggaggat
gtaaagcccgaggaactcatagctatattccctaagaaacttattgagcaggagtttagt
actgagagattcattaagattccagatgaattgctatccctatacctagaacttggtaga
cctactcctttgtttagggctaggaggcttgaggagtttttggatactcctgcaaggata
tattataagtatgagggtgtattgccaacaggttcacacaagataaatacagctatagca
caagcatatttcaatatgcttgaaggtactaaaaggcttactacagagactggagctggg
caatggggatctgcgctagccttggcgggagctctctttggtctaaaggttagggtttat
atggttagagctagctatgatcagaagccatataggagaatacttatgcagatatatggt
gcagaggttatacccagcccaagtccatataccaagagcggtagagagattcttgagaga
gatcctaatcaccctggttctcttggtatagctattagtgaagctatagaggatgcagtt
acaaatcctggtacaaagtatagtcttgggtcggtattaaaccatgtacttttacaccaa
acgataataggtctagaggctattaagcaatttgagcttattggtgaagagctaccagat
atagttataggatgtgttggtggtggaagtaattttgcaggactagcatatccattctac
tatgaggagattgttagggggaagaagaaatctgttaaaatcatagctgtagagccaaag
gcagttccatcaatgaccaggggtatatatacatatgactatggagatacagcaagatta
acaccaatgctaaagatgtatacagttggacatagatacacccctccaccaatacatgca
ggaggacttagataccacggtgttgcaccaacacttgcacttctagtgaaaaacaatatc
gttaaacctgtagcatatcatcagacagaggtatttagagctgcacaactatttgcacag
atggagggtattgttcctgctcctgagtctgcacatgcagttaaagctgttattgatgaa
gctataagagctagagaagagagggagaagaaggtaataatattcaatctaagtggacat
ggactacttgatttagcaggatatcaggagtatcttgagaatagacttagggactacgaa
ccagagaaaatagatttatcatatcttaatacatattga

DBGET integrated database retrieval system