KEGG   Ignisphaera aggregans: Igag_1716Help
Entry
Igag_1716         CDS       T01307                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
iag  Ignisphaera aggregans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igag_1716
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1716
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igag_1716
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Igag_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1595628..1596959
Genome map
AA seq 443 aa AA seqDB search
MFIVLRDKYEPMVNICPKYIDEILPSYWYNIIPDLPKPLPPPRDPEDTSSRIDLLRKILP
REVLRQQFTVERFVKIPDEIRDMYEVIGRPTPLFRARRLEEFLDTPARIYYKYEGVLPTG
SHKINTAIAQAYYALNDGVNGVTTETGAGQWGSAVALAASLYGLKSYVFMVRVSYEHKPG
RKHLMEFYGAEVIPSPSKLTKIGREILERDPENPGSLGIAISEAIEYAIDHGYKYLMGSV
LDVVLLHQSIIGLEAIKQFELIGEELPDIVIGCVGGGSNFAGLAYPFIGLKNNSSRRYIA
AASSAVPKFSKGVYRYDFPDTAGLLPLVKMITLGKDFIPPPIYSGGLRYHGLAPSLSLLV
NEGVIEWREYSEEEILRAAQIFAKTQGIVPAPESAHAVKAVIDEAIRAREEREKKVIIFN
LSGHGLLDIENYGSMMKRYSIKW
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatagttctgagggataaatatgagccaatggtaaatatatgtcctaaatatata
gatgagattctccctagctattggtataacataatacctgatctaccaaagccattacct
ccaccaagagaccctgaagatacatcctctagaatagatctattgagaaaaatacttcct
agggaagtactgaggcaacagtttacagttgaacgctttgtcaagatcccagatgagata
agagacatgtatgaggttattggtagacctactcctttgtttagggctaggaggcttgag
gagtttttggatactcctgcaaggatatattataagtatgagggtgtattgccaacaggt
tcacacaagataaatacagctatagcacaagcatattatgctctaaatgatggtgttaat
ggtgttacgactgagactggagctggacagtggggatctgctgtagctctagctgcatcg
ctttatgggttaaagtcatatgtgtttatggttagagtaagctatgagcataagcctggg
aggaaacatctaatggaattctatggagcagaggttatccctagtccatcgaagcttaca
aagattggtagagagattcttgagagagatccagagaatcctggttctcttggtatagct
attagtgaagctattgagtatgctattgatcatggatataagtatctaatgggtagtgta
ctagatgttgtactcctccaccagagtatcattggtttagaggctattaagcaatttgag
cttattggtgaagagctaccagatatagttataggatgtgttggtggtggaagtaatttc
gctggactagcatatccattcataggacttaaaaacaactctagtagaagatatatagct
gcagcttcttcagctgttccaaagttttcaaagggtgtatatagatatgacttccctgat
acagctggtctactaccactagtaaagatgataacacttgggaaagactttataccacca
cctatatactcaggaggacttagatatcatgggcttgcaccatcactaagtctattggtt
aatgagggagttatagagtggagagagtatagtgaggaagagatacttagagctgcacag
atattcgctaagacacagggtattgttcctgctcctgagtctgcacatgcagttaaagct
gttattgatgaagctataagagctagagaagagagggagaagaaggtaataatattcaat
ctaagtggacatggactactcgatatagagaactatggatctatgatgaagagatattct
atcaaatggtaa

DBGET integrated database retrieval system