KEGG   Ignisphaera aggregans: Igag_1716Help
Entry
Igag_1716         CDS       T01307                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
iag  Ignisphaera aggregans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igag_1716
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1716
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igag_1716
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Igag_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1595628..1596959
Genome map
AA seq 443 aa AA seqDB search
MFIVLRDKYEPMVNICPKYIDEILPSYWYNIIPDLPKPLPPPRDPEDTSSRIDLLRKILP
REVLRQQFTVERFVKIPDEIRDMYEVIGRPTPLFRARRLEEFLDTPARIYYKYEGVLPTG
SHKINTAIAQAYYALNDGVNGVTTETGAGQWGSAVALAASLYGLKSYVFMVRVSYEHKPG
RKHLMEFYGAEVIPSPSKLTKIGREILERDPENPGSLGIAISEAIEYAIDHGYKYLMGSV
LDVVLLHQSIIGLEAIKQFELIGEELPDIVIGCVGGGSNFAGLAYPFIGLKNNSSRRYIA
AASSAVPKFSKGVYRYDFPDTAGLLPLVKMITLGKDFIPPPIYSGGLRYHGLAPSLSLLV
NEGVIEWREYSEEEILRAAQIFAKTQGIVPAPESAHAVKAVIDEAIRAREEREKKVIIFN
LSGHGLLDIENYGSMMKRYSIKW
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatagttctgagggataaatatgagccaatggtaaatatatgtcctaaatatata
gatgagattctccctagctattggtataacataatacctgatctaccaaagccattacct
ccaccaagagaccctgaagatacatcctctagaatagatctattgagaaaaatacttcct
agggaagtactgaggcaacagtttacagttgaacgctttgtcaagatcccagatgagata
agagacatgtatgaggttattggtagacctactcctttgtttagggctaggaggcttgag
gagtttttggatactcctgcaaggatatattataagtatgagggtgtattgccaacaggt
tcacacaagataaatacagctatagcacaagcatattatgctctaaatgatggtgttaat
ggtgttacgactgagactggagctggacagtggggatctgctgtagctctagctgcatcg
ctttatgggttaaagtcatatgtgtttatggttagagtaagctatgagcataagcctggg
aggaaacatctaatggaattctatggagcagaggttatccctagtccatcgaagcttaca
aagattggtagagagattcttgagagagatccagagaatcctggttctcttggtatagct
attagtgaagctattgagtatgctattgatcatggatataagtatctaatgggtagtgta
ctagatgttgtactcctccaccagagtatcattggtttagaggctattaagcaatttgag
cttattggtgaagagctaccagatatagttataggatgtgttggtggtggaagtaatttc
gctggactagcatatccattcataggacttaaaaacaactctagtagaagatatatagct
gcagcttcttcagctgttccaaagttttcaaagggtgtatatagatatgacttccctgat
acagctggtctactaccactagtaaagatgataacacttgggaaagactttataccacca
cctatatactcaggaggacttagatatcatgggcttgcaccatcactaagtctattggtt
aatgagggagttatagagtggagagagtatagtgaggaagagatacttagagctgcacag
atattcgctaagacacagggtattgttcctgctcctgagtctgcacatgcagttaaagct
gttattgatgaagctataagagctagagaagagagggagaagaaggtaataatattcaat
ctaagtggacatggactactcgatatagagaactatggatctatgatgaagagatattct
atcaaatggtaa

DBGET integrated database retrieval system