KEGG   Ignisphaera aggregans: Igag_1717Help
Entry
Igag_1717         CDS       T01307                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
iag  Ignisphaera aggregans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igag_1717
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1717
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igag_1717
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Igag_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1596972..1597703
Genome map
AA seq 243 aa AA seqDB search
MKYLVVYLTAGFPNDRIFMDIASKLKDRGVNYLEIGIPPKYAKYDGPVIRKSYRYVKSLS
IDVWRILKETVKIVDIPIILLTYLEEYVDNYRQFLENVYSIGIDSILFPDLLIDLVDRYI
EYIDIAKSIGIKIVLFVTPSMPDKFIENISPLSSHFLYYGIRPTTGIPIPITSSTLVKRI
RGFVRNKLVVGFGLSIDEIADVVRAGADGIAIGSAIIEKLESNDFDGALKLIEDIRGVLN
GVE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatctagttgtgtatctcacagctggttttccaaatgatagaatattcatggat
attgcaagcaaattgaaggatagaggcgttaactatctagagataggtatacctccaaaa
tatgctaaatatgatggacctgtgattaggaagagctatagatatgtaaagtcgttgagt
atagatgtgtggagaattctgaaagagactgtaaagattgttgatatacccataatccta
ctaacatatctagaggaatatgttgataactatagacaattcctagaaaatgtatatagc
attggtattgactctatactattcccagatctattgatagaccttgtcgatagatatata
gagtatatcgatatagctaagtctataggtataaagatagttctatttgttacaccgtca
atgcccgataaattcatagagaatatatcaccactatcaagccactttctatactatgga
attaggcctacaactggtataccaataccaataacatcttctacattggttaaaaggatt
aggggatttgtaaggaacaaacttgtagtaggatttggactatctatagatgagattgca
gatgttgtaagagctggtgctgatggtatagcaataggctcggcaattattgaaaaactt
gagtctaatgattttgatggtgctctaaagcttattgaggatataaggggtgttctcaat
ggtgtcgaatag

DBGET integrated database retrieval system