KEGG   Ignisphaera aggregans: Igag_1722Help
Entry
Igag_1722         CDS       T01307                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
iag  Ignisphaera aggregans
Pathway
iag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01130  Biosynthesis of antibiotics
iag01230  Biosynthesis of amino acids
Module
iag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Igag_1722
Enzymes [BR:iag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Igag_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE QRPTase_C DHO_dh His_biosynth DUF871 PI3K_rbd
Motif
Other DBs
NCBI-ProteinID: ADM28519
UniProt: E0SS62
Position
1601152..1601895
Genome map
AA seq 247 aa AA seqDB search
MPRELYGWLKDVVEHALRRPVIKMYRDRPRYSIIESIQRKQSLGLNPIIAEYKRRSPSGL
YVVRDLYDYLSLMEKYATGISILTEDKYFGGSYEILREASRILRLPILMKDFIVCEHQIE
TAYNIGADTILLILSILTEEEAEKLYRYAKSFGLEVIVEVNTVDEAVLAMEMGVEIIGIN
SRNLKTLEIDMDRTCEIMKNISSNTIKIAESGIKSRSDIEKLKICGANAFLIGTSLMKNP
KNILEYI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctagagaactatatggatggctaaaagatgttgttgaacatgccctgagaagacct
gttataaagatgtatagggatagacctcgctatagtattatagagtcgatccagagaaaa
caaagcctaggtctcaatccgattatagctgagtataagaggagatctccatcaggtcta
tatgttgttagagacctatacgattatctctctctaatggagaaatacgctactggaata
agcatattgacagaagataaatattttggaggatcatatgaaattcttagagaagcatca
agaatcctaagactaccgatactgatgaaggattttatagtctgtgaacaccagattgaa
acagcatataatattggtgctgacaccattctattaatactatcgatactaactgaagaa
gaagctgagaaactctatagatatgctaagagctttggcctagaggttattgtagaggtt
aatacggtagacgaagccgtgttagctatggaaatgggtgtagagataataggtataaac
tctagaaatctaaaaacacttgaaatagatatggatagaacatgtgaaattatgaaaaac
atatctagcaatactataaagatagctgagagtggtataaagagtagatcagatatagaa
aaactaaagatctgtggtgcaaatgcctttctcataggtacatcgcttatgaaaaacccc
aagaatattcttgaatatatatag

DBGET integrated database retrieval system