KEGG   Ignisphaera aggregans: Igag_1772Help
Entry
Igag_1772         CDS       T01307                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igag_1772
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1772
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Igag_1772
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Igag_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1651447..1652649)
Genome map
AA seq 400 aa AA seqDB search
MNKHKSRLFKENVLLRCINCGSIYEADPWLFICPRCRGLLEVEMPSNIEVDFRSIANRRM
GVWKYKELLPLGNDIKPITMGEGGTPLIKLSRVMEALNINGIEAYVKFEGANPTGSFKDR
GMTVGVTIAKYIGVKGVIVASTGNTAASAAAYAARAGIKCIVVLPKGGVAKGKIAQALLH
GAEVMELDGTFDDALEEVFMNVTSSNSRDLYPLNSYNPWRLEGQKTIAFEVVDELGIVPD
AVIVPVGNAGNISAIWKGFKELYRYGLIRELPRMIGIQAEGAAPLASAWSRGLDTPQFIE
KPMTIASAIRIGRPVNWMKAVRAVRESKGTFISVTDEEILESIKILARFEGIGVEPASAT
TLAGLIKAYNNGIIERNSTVVLIATGHALKDPDTIIRYSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ataaataaacataagtctaggttatttaaagaaaatgtattacttagatgtataaattgt
ggatctatatatgaagcagatccatggcttttcatatgcccccgttgtagaggtttacta
gaagtagagatgccaagcaacatagaggttgattttagatctattgctaatagaaggatg
ggtgtatggaaatataaggagttacttccattgggtaatgatattaaacctattactatg
ggagagggaggaacaccattaataaagcttagtagggttatggaggctctaaatatcaat
ggtatagaggcttatgttaagtttgagggtgcaaatccaactgggagttttaaagatagg
gggatgactgtaggggtaactatagctaagtatataggggtaaaaggtgttatagttgca
agtactggaaatacagcagcttcagcagctgcttatgctgctagagctggtattaaatgt
attgttgtattgcctaagggaggtgttgcaaagggtaagatagctcaagcacttcttcat
ggggcagaggttatggaattggatggtacgtttgatgatgctctagaggaggtgtttatg
aatgttactagctctaattcaagggatctctatccgctaaactcttataatccatggaga
ttagagggtcagaagactatagcttttgaggttgttgatgagcttggaattgttcctgac
gctgttattgtacctgttgggaatgctggtaatatatctgctatttggaagggctttaaa
gagctgtatagatatggattgataagagagttgccaaggatgataggaatacaggcagag
ggtgcagcacctcttgctagtgcatggagtagaggtctagatacacctcagtttattgag
aagcctatgacaatagcatctgctataagaataggtaggcctgttaactggatgaaggca
gtgagagctgttagagagtccaaggggacatttatttctgtaactgatgaagagatttta
gagtctataaagattctagcaagatttgagggtataggtgtagaaccagcaagtgctact
actctagctggacttattaaagcatataacaatggtattatagagagaaatagtactgtt
gtacttattgctactggtcatgctctaaaggatcctgataccattattaggtatagctta
taa

DBGET integrated database retrieval system