KEGG   Ignisphaera aggregans: Igag_1772Help
Entry
Igag_1772         CDS       T01307                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
iag  Ignisphaera aggregans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Igag_1772
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1772
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Igag_1772
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Igag_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1651447..1652649)
Genome map
AA seq 400 aa AA seqDB search
MNKHKSRLFKENVLLRCINCGSIYEADPWLFICPRCRGLLEVEMPSNIEVDFRSIANRRM
GVWKYKELLPLGNDIKPITMGEGGTPLIKLSRVMEALNINGIEAYVKFEGANPTGSFKDR
GMTVGVTIAKYIGVKGVIVASTGNTAASAAAYAARAGIKCIVVLPKGGVAKGKIAQALLH
GAEVMELDGTFDDALEEVFMNVTSSNSRDLYPLNSYNPWRLEGQKTIAFEVVDELGIVPD
AVIVPVGNAGNISAIWKGFKELYRYGLIRELPRMIGIQAEGAAPLASAWSRGLDTPQFIE
KPMTIASAIRIGRPVNWMKAVRAVRESKGTFISVTDEEILESIKILARFEGIGVEPASAT
TLAGLIKAYNNGIIERNSTVVLIATGHALKDPDTIIRYSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ataaataaacataagtctaggttatttaaagaaaatgtattacttagatgtataaattgt
ggatctatatatgaagcagatccatggcttttcatatgcccccgttgtagaggtttacta
gaagtagagatgccaagcaacatagaggttgattttagatctattgctaatagaaggatg
ggtgtatggaaatataaggagttacttccattgggtaatgatattaaacctattactatg
ggagagggaggaacaccattaataaagcttagtagggttatggaggctctaaatatcaat
ggtatagaggcttatgttaagtttgagggtgcaaatccaactgggagttttaaagatagg
gggatgactgtaggggtaactatagctaagtatataggggtaaaaggtgttatagttgca
agtactggaaatacagcagcttcagcagctgcttatgctgctagagctggtattaaatgt
attgttgtattgcctaagggaggtgttgcaaagggtaagatagctcaagcacttcttcat
ggggcagaggttatggaattggatggtacgtttgatgatgctctagaggaggtgtttatg
aatgttactagctctaattcaagggatctctatccgctaaactcttataatccatggaga
ttagagggtcagaagactatagcttttgaggttgttgatgagcttggaattgttcctgac
gctgttattgtacctgttgggaatgctggtaatatatctgctatttggaagggctttaaa
gagctgtatagatatggattgataagagagttgccaaggatgataggaatacaggcagag
ggtgcagcacctcttgctagtgcatggagtagaggtctagatacacctcagtttattgag
aagcctatgacaatagcatctgctataagaataggtaggcctgttaactggatgaaggca
gtgagagctgttagagagtccaaggggacatttatttctgtaactgatgaagagatttta
gagtctataaagattctagcaagatttgagggtataggtgtagaaccagcaagtgctact
actctagctggacttattaaagcatataacaatggtattatagagagaaatagtactgtt
gtacttattgctactggtcatgctctaaaggatcctgataccattattaggtatagctta
taa

DBGET integrated database retrieval system