KEGG   Ignisphaera aggregans: Igag_1772Help
Entry
Igag_1772         CDS       T01307                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
iag  Ignisphaera aggregans
Pathway
iag00260  Glycine, serine and threonine metabolism
iag00750  Vitamin B6 metabolism
iag01100  Metabolic pathways
iag01110  Biosynthesis of secondary metabolites
iag01120  Microbial metabolism in diverse environments
iag01230  Biosynthesis of amino acids
Module
iag_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Igag_1772
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Igag_1772
Enzymes [BR:iag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Igag_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ADM28569
UniProt: E0SSB2
Position
complement(1651447..1652649)
Genome map
AA seq 400 aa AA seqDB search
MNKHKSRLFKENVLLRCINCGSIYEADPWLFICPRCRGLLEVEMPSNIEVDFRSIANRRM
GVWKYKELLPLGNDIKPITMGEGGTPLIKLSRVMEALNINGIEAYVKFEGANPTGSFKDR
GMTVGVTIAKYIGVKGVIVASTGNTAASAAAYAARAGIKCIVVLPKGGVAKGKIAQALLH
GAEVMELDGTFDDALEEVFMNVTSSNSRDLYPLNSYNPWRLEGQKTIAFEVVDELGIVPD
AVIVPVGNAGNISAIWKGFKELYRYGLIRELPRMIGIQAEGAAPLASAWSRGLDTPQFIE
KPMTIASAIRIGRPVNWMKAVRAVRESKGTFISVTDEEILESIKILARFEGIGVEPASAT
TLAGLIKAYNNGIIERNSTVVLIATGHALKDPDTIIRYSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ataaataaacataagtctaggttatttaaagaaaatgtattacttagatgtataaattgt
ggatctatatatgaagcagatccatggcttttcatatgcccccgttgtagaggtttacta
gaagtagagatgccaagcaacatagaggttgattttagatctattgctaatagaaggatg
ggtgtatggaaatataaggagttacttccattgggtaatgatattaaacctattactatg
ggagagggaggaacaccattaataaagcttagtagggttatggaggctctaaatatcaat
ggtatagaggcttatgttaagtttgagggtgcaaatccaactgggagttttaaagatagg
gggatgactgtaggggtaactatagctaagtatataggggtaaaaggtgttatagttgca
agtactggaaatacagcagcttcagcagctgcttatgctgctagagctggtattaaatgt
attgttgtattgcctaagggaggtgttgcaaagggtaagatagctcaagcacttcttcat
ggggcagaggttatggaattggatggtacgtttgatgatgctctagaggaggtgtttatg
aatgttactagctctaattcaagggatctctatccgctaaactcttataatccatggaga
ttagagggtcagaagactatagcttttgaggttgttgatgagcttggaattgttcctgac
gctgttattgtacctgttgggaatgctggtaatatatctgctatttggaagggctttaaa
gagctgtatagatatggattgataagagagttgccaaggatgataggaatacaggcagag
ggtgcagcacctcttgctagtgcatggagtagaggtctagatacacctcagtttattgag
aagcctatgacaatagcatctgctataagaataggtaggcctgttaactggatgaaggca
gtgagagctgttagagagtccaaggggacatttatttctgtaactgatgaagagatttta
gagtctataaagattctagcaagatttgagggtataggtgtagaaccagcaagtgctact
actctagctggacttattaaagcatataacaatggtattatagagagaaatagtactgtt
gtacttattgctactggtcatgctctaaaggatcctgataccattattaggtatagctta
taa

DBGET integrated database retrieval system