KEGG   Ignisphaera aggregans: Igag_1816Help
Entry
Igag_1816         CDS       T01307                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
iag  Ignisphaera aggregans
Brite
Enzymes [BR:iag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Igag_1816
Transfer RNA biogenesis [BR:iag03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Igag_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702726..1704168
Genome map
AA seq 480 aa AA seqDB search
MMLTIRSIKRVTRALSGVTVVAVMTKPYPCPHGKCIYCPGGPEFGTPQSYIGREPALMRG
LQTNFDPYEQTQLRLRQYEVNGHIPSKVEVIVMGGTFTAMPRDYQEWFITNIFEAVNRYP
EPKPSVLPSLEEAHLRNETARIRVVGLTIETRPDWAKEKQIDFMLYLGATKVEIGVQSIY
DDVLKYINRGHTVKDVIEATRLLKDAGFKVVYHIMPRLPKSDRDRDIAMIREIFENPDFR
PDMLKIYPTLVIEGTKLYELWRQGLYKPLTDEEAIELLSEFYRYIPRWVRIMRIQRDIPA
ELIVAGPRKANLRELVEKRALEKGIVINEIRFREVGRQYLYRGRRAHKITITREYYEASM
GTEIFLAAEDIENNIIVGLLRLRIPSEKAHRPEINPRTAIVRELHVYGLQVPIGSYIDDA
WQHKGWGRELLRTAETIAREEFSCTKIYVLSGVGAREYYRKHGYRRAPNSIYMVKDLKDI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaacaattagaagtattaagagagttacaagagctctctctggagtaacagtt
gtagctgttatgacaaaaccttatccatgtccacatggaaagtgtatctactgtcctggt
ggtccagagtttggtactccgcaaagctatataggtagagaaccagctcttatgaggggt
ctccaaacaaattttgatccctatgaacagacacagcttagattgagacaatatgaggtt
aatggacatatacctagtaaggttgaggtcattgttatgggcggaacttttacagctatg
cctagagactatcaggagtggttcattacaaatatatttgaggctgtaaatagatatcct
gagccaaaaccatctgtacttccatcattagaggaggctcatttaagaaatgaaactgct
agaattagagttgttggactaacaattgagactagacctgattgggcaaaagagaaacag
atagatttcatgctttatcttggtgcaacaaaagttgaaataggtgttcagagtatctat
gacgatgtacttaaatatatcaatagagggcatacagtaaaggatgttattgaagctaca
agactattgaaagatgcaggatttaaggttgtttatcatattatgcctaggctaccgaaa
tctgatcgtgatagagatatagcgatgataagagagatttttgaaaatcctgattttaga
cccgatatgcttaagatatatccaactctagttatagaaggtacaaaactctatgaacta
tggagacagggtctctataaacctttaacagatgaagaagctattgagctcttatcagaa
ttctatagatatataccaaggtgggttaggattatgaggatacagagagatattcctgca
gaactcatagttgctggccctagaaaagcaaatctacgtgaacttgttgagaaaagagct
ttagagaagggtattgttattaacgagattaggtttagagaggtgggtagacagtatcta
tataggggtagaagagctcataaaataacaataactagggaatactatgaggcgagtatg
ggtacagagatatttttagcagctgaagacatagagaataatataattgttggtcttctc
agattaagaataccgtcagagaaagcccatagaccagagataaatcctaggacagcaata
gtaagagaactacatgtatatgggttacaggttcctataggaagctatatagatgatgca
tggcagcacaagggctggggcagagagttgctaagaacagcagagactattgcgagagag
gagtttagctgtaccaagatatatgtgctatctggtgtaggcgcacgtgaatactatagg
aagcatggatatagaagagctccaaactctatctacatggtcaaagatcttaaagatatc
taa

DBGET integrated database retrieval system