KEGG   Ignisphaera aggregans: Igag_1823Help
Entry
Igag_1823         CDS       T01307                                 

Definition
sugar isomerase (SIS)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
iag  Ignisphaera aggregans
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:iag00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Igag_1823
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Igag_1823
Enzymes [BR:iag01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Igag_1823
Peptidases [BR:iag01002]
 Cysteine Peptidases
  Family C44
   Igag_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710471..1712294
Genome map
AA seq 607 aa AA seqDB search
MGGIFGALSPKKSNVIDVVISGLKRLEYRGFSGSGIAFLQDNDLVIYKDAVRIDKLIELY
RLDEVSSWIAIGQTRYATHGKPHKNNTEPHTDCKNSLAIVGDGAIENYEFLKDATIIRGH
KVVSKCDFEIIVHMIEDELGRYRDIVRSINSVVKDLEGFYTFALLLRDYNSIVLYTSLQP
IFIGISKNIYLFSSNKSSMYGIADRYIELGANELGIISENGVDVYSLSTQSRVVKEERNL
DVDPRFIDRGGFPHHMIREIYEIPFSLLRTISSVQDKYLSLSARFIIEARNVFIIGNGTS
LHAGLVASYYLSELANVNPIVVSAAEFPLYYVDNIAPGSLVIAISQSGETGDVLQSVYEA
KLRGATILGITNYIGSRLANLSNIYLPIGAGPEISIPATKTFTSTLMLLYMLALKASRYR
GNIDESEYKDGIKYAKIMAQSLNEYMHRIDKDVAKVVKFISQCRSGYIVSRGITYPIALE
GALKFKETAYVHAEGVEAGEFKHGPQSLLDENIFTIFIIPTEKIAIEPTYSLISMAKEYK
TKTIVIGYEGDQKLDELGDIPVIKLPAVKRHLTPIIATIPLQFLAYRLGIELGRPIDTPR
YLSKTVH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggaatttttggtgctttatctccaaaaaagagtaatgttatagatgttgtgatt
agcggtttaaagagattggaatatagaggcttcagtggaagtggtatagcatttttacaa
gataatgatttagttatatataaagatgctgttagaattgataaacttatagagctatat
agattagatgaagtttcgagctggattgctataggccagactagatatgctacccatgga
aagcctcataagaataatactgagcctcataccgattgtaagaattctctagctatagtc
ggtgatggagctatagaaaactatgagtttcttaaggatgccacaataatacgtggacac
aaagttgtatcgaaatgtgattttgagattatagttcatatgattgaagatgaattaggt
agatatagagatattgttagaagtattaatagtgttgttaaagatcttgaaggattctat
acatttgcgctacttcttagagactataactctattgttttatatacatcgcttcaacca
atatttataggtatttcaaagaatatatatctattttcatcaaataaaagttctatgtat
ggtatagcagatagatatatcgaacttggtgcaaatgaacttggaattatttctgagaat
ggagttgatgtatatagtctctctacacagtccagggttgtaaaagaggagaggaatctc
gatgttgatcctagatttatagatagaggtggttttccacatcatatgattagagagatc
tatgagatacctttctcattattgagaactatatcatctgtacaagataaatatttatcg
cttagtgctagattcattattgaagctagaaatgtatttataataggtaatggaactagt
cttcatgcaggtcttgtggcatcatattatctatcagagttagcaaatgttaatccaata
gtagttagtgctgcagaatttcctctctactacgtagataatatagcaccgggatcgctg
gttatagcaatttcacaatctggagagacaggagatgttctacaatctgtttatgaagct
aagctaaggggtgctacaattcttggaataaccaactacattggttctcgcttagccaat
ctatccaatatatatctaccgataggagcgggtcccgaaatttctataccagcaacaaag
acatttacatcaaccttaatgcttctctatatgcttgcactaaaagcctcaagatataga
ggaaatattgatgaatctgaatataaggatggaattaaatatgctaagatcatggcacaa
agtcttaatgagtatatgcataggatagataaagatgtagcaaaagtagtgaaattcata
tcacagtgtagaagtggctatatagtttcacgaggaattacatatccaatagcattagaa
ggtgctttaaaatttaaggagacagcctatgttcatgcggagggtgttgaagctggagaa
tttaaacatggaccccaatcacttcttgacgagaatatctttaccatattcattatacct
acagagaagatagctatagaacctacatatagcttaatatcaatggcaaaggaatataaa
actaagactatagtcataggttatgaaggagatcagaaactagatgaacttggcgatata
cctgtaataaaattaccagcagtaaagagacatctaacaccgataattgcaacaatacca
ctccaattcttagcatatagacttgggatagagcttggaagacctatagatacaccgaga
tatctatcaaagactgttcactag

DBGET integrated database retrieval system