KEGG   Ignisphaera aggregans: Igag_1823Help
Entry
Igag_1823         CDS       T01307                                 

Definition
sugar isomerase (SIS)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
iag  Ignisphaera aggregans
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:iag00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:iag00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710471..1712294
Genome map
AA seq 607 aa AA seqDB search
MGGIFGALSPKKSNVIDVVISGLKRLEYRGFSGSGIAFLQDNDLVIYKDAVRIDKLIELY
RLDEVSSWIAIGQTRYATHGKPHKNNTEPHTDCKNSLAIVGDGAIENYEFLKDATIIRGH
KVVSKCDFEIIVHMIEDELGRYRDIVRSINSVVKDLEGFYTFALLLRDYNSIVLYTSLQP
IFIGISKNIYLFSSNKSSMYGIADRYIELGANELGIISENGVDVYSLSTQSRVVKEERNL
DVDPRFIDRGGFPHHMIREIYEIPFSLLRTISSVQDKYLSLSARFIIEARNVFIIGNGTS
LHAGLVASYYLSELANVNPIVVSAAEFPLYYVDNIAPGSLVIAISQSGETGDVLQSVYEA
KLRGATILGITNYIGSRLANLSNIYLPIGAGPEISIPATKTFTSTLMLLYMLALKASRYR
GNIDESEYKDGIKYAKIMAQSLNEYMHRIDKDVAKVVKFISQCRSGYIVSRGITYPIALE
GALKFKETAYVHAEGVEAGEFKHGPQSLLDENIFTIFIIPTEKIAIEPTYSLISMAKEYK
TKTIVIGYEGDQKLDELGDIPVIKLPAVKRHLTPIIATIPLQFLAYRLGIELGRPIDTPR
YLSKTVH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggaatttttggtgctttatctccaaaaaagagtaatgttatagatgttgtgatt
agcggtttaaagagattggaatatagaggcttcagtggaagtggtatagcatttttacaa
gataatgatttagttatatataaagatgctgttagaattgataaacttatagagctatat
agattagatgaagtttcgagctggattgctataggccagactagatatgctacccatgga
aagcctcataagaataatactgagcctcataccgattgtaagaattctctagctatagtc
ggtgatggagctatagaaaactatgagtttcttaaggatgccacaataatacgtggacac
aaagttgtatcgaaatgtgattttgagattatagttcatatgattgaagatgaattaggt
agatatagagatattgttagaagtattaatagtgttgttaaagatcttgaaggattctat
acatttgcgctacttcttagagactataactctattgttttatatacatcgcttcaacca
atatttataggtatttcaaagaatatatatctattttcatcaaataaaagttctatgtat
ggtatagcagatagatatatcgaacttggtgcaaatgaacttggaattatttctgagaat
ggagttgatgtatatagtctctctacacagtccagggttgtaaaagaggagaggaatctc
gatgttgatcctagatttatagatagaggtggttttccacatcatatgattagagagatc
tatgagatacctttctcattattgagaactatatcatctgtacaagataaatatttatcg
cttagtgctagattcattattgaagctagaaatgtatttataataggtaatggaactagt
cttcatgcaggtcttgtggcatcatattatctatcagagttagcaaatgttaatccaata
gtagttagtgctgcagaatttcctctctactacgtagataatatagcaccgggatcgctg
gttatagcaatttcacaatctggagagacaggagatgttctacaatctgtttatgaagct
aagctaaggggtgctacaattcttggaataaccaactacattggttctcgcttagccaat
ctatccaatatatatctaccgataggagcgggtcccgaaatttctataccagcaacaaag
acatttacatcaaccttaatgcttctctatatgcttgcactaaaagcctcaagatataga
ggaaatattgatgaatctgaatataaggatggaattaaatatgctaagatcatggcacaa
agtcttaatgagtatatgcataggatagataaagatgtagcaaaagtagtgaaattcata
tcacagtgtagaagtggctatatagtttcacgaggaattacatatccaatagcattagaa
ggtgctttaaaatttaaggagacagcctatgttcatgcggagggtgttgaagctggagaa
tttaaacatggaccccaatcacttcttgacgagaatatctttaccatattcattatacct
acagagaagatagctatagaacctacatatagcttaatatcaatggcaaaggaatataaa
actaagactatagtcataggttatgaaggagatcagaaactagatgaacttggcgatata
cctgtaataaaattaccagcagtaaagagacatctaacaccgataattgcaacaatacca
ctccaattcttagcatatagacttgggatagagcttggaagacctatagatacaccgaga
tatctatcaaagactgttcactag

DBGET integrated database retrieval system