KEGG   Ignavibacterium album: IALB_0228Help
Entry
IALB_0228         CDS       T01943                                 

Gene name
hemB
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ial  Ignavibacterium album
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IALB_0228 (hemB)
Enzymes [BR:ial01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     IALB_0228 (hemB)
Exosome [BR:ial04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IALB_0228 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(238940..239926)
Genome map
AA seq 328 aa AA seqDB search
MSQYPIIRHRRLRYNPIIRDMVRETVLAKDDLIYPLFVVPGSNVKNPVKSMPGVFQMSID
NIVEECKEVRDLGIPAIILFGIPEHKDEKGSEAYDPEGIIQRAVRAIKTEVKDLVVITDV
CMCEYTSHGHCGLLQGEEILNDETVELLAKEALTHAQAGADMIAPSDMMDGRVAAIRKIL
DDNGFNKIPIMSYAAKYASGFYGPFRDAAESTPAFGDRRSHQMDIGNINEAIREVEEDIK
EGADIVMVKPAGPYLDVIREVKQRFGMPTAAYQVSGEYSMIKAAGANGWIDEERVMVEAA
FAIKRAGADMFLTYFAKDLAKWIDKTNK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatccaataatcaggcacagaagattaagatacaatccaattatcagagat
atggtaagagaaactgttcttgccaaggatgatcttatttacccgttgtttgttgtgccg
ggaagcaatgttaaaaatcctgtaaagtcaatgcccggtgtttttcaaatgtctattgat
aacatagttgaagaatgcaaagaagtccgtgatcttgggattcctgcaataattctattt
ggaattcctgagcacaaagatgaaaaaggttctgaagcatatgaccctgaaggtataatt
cagagagcagttcgtgcaattaaaacggaagtaaaagatttagttgttataaccgatgta
tgtatgtgtgaatatacttcgcacggacactgtggtcttttgcaaggtgaagaaattctg
aatgatgaaacagtggaacttctcgccaaagaagcacttactcacgcacaagctggcgct
gatatgattgctccttctgatatgatggacggaagagttgctgcaataagaaaaattctt
gatgataacggatttaataagattccaattatgagttatgcagcaaaatatgcaagcgga
ttctacggaccattcagagatgcagcagaatcaactccggcttttggtgacagaagatcg
catcaaatggatattggtaatattaatgaagccattcgtgaagttgaagaagatattaaa
gaaggtgcagatattgtaatggttaaaccagccggtccttatcttgatgtaatcagagag
gtgaagcagagatttggaatgccaactgcagcttatcaggttagtggtgagtactcaatg
attaaagcagccggtgcaaatggctggattgatgaagaacgtgttatggttgaagctgct
tttgcaattaaacgagccggcgctgatatgttcctgacttattttgccaaagatttagct
aaatggatagataaaacaaataaatag

DBGET integrated database retrieval system