KEGG   Ignavibacterium album: IALB_0315Help
Entry
IALB_0315         CDS       T01943                                 

Gene name
ruvA
Definition
Holliday junction resolvasome DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ial  Ignavibacterium album
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ial03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(339764..340345)
Genome map
AA seq 193 aa AA seqDB search
MIGYLKGKIISAKPTKIILDVNGVGYLVNISISTFEKISDSQEISLFIHTHVREDALSLY
GFYTEAEKEMFELLISISGIGPKVALSILSGISVDELQNAIQTENVSRLVSVPGVGRKTA
ERVVLELKSKVGFIETTVQKGIDYTVKQEAVLALTTLGYNQKVAEKIVRDLLNENPTLSL
EDLIRKSLSELNK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgataggatatctgaaaggaaaaataatttctgcaaaaccaaccaaaataattcttgat
gtaaatggtgttggctatcttgtaaacatttcaataagcactttcgaaaaaatttctgat
agtcaggagatttcgcttttcatacatactcatgtccgggaagatgctttatcactttat
ggattttacaccgaagctgagaaagaaatgtttgagcttctgatttcaatcagcggaata
ggacctaaagtggcattaagtattttatccgggatttctgtagatgaacttcagaatgca
attcagacagagaatgtatcgagattggtttcagtaccgggcgtcggaagaaaaactgca
gaaagagttgtgcttgaactgaaaagtaaagtcggatttattgaaaccacagttcagaaa
ggaattgattacactgttaaacaggaggcagtacttgcacttacaactttaggttataat
cagaaggtggcagaaaaaattgtaagagatttacttaatgaaaatccgactctttcactt
gaagatttaatcagaaaatctctttcagagctaaacaaataa

DBGET integrated database retrieval system