KEGG   Ignavibacterium album: IALB_0708Help
Entry
IALB_0708         CDS       T01943                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ial  Ignavibacterium album
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    IALB_0708 (gmk)
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     IALB_0708 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785286..785861
Genome map
AA seq 191 aa AA seqDB search
MSDKKGKIIVISSPSGGGKTTIVRKILSELPEIVFSVSATTRPKRPDEIDGVHYFFLTDK
EFEEKIKNNEFIEWERFYDYYYGTLKTFVLDNIEKGKTVLLEIDVKGAISVKKLFSDAIL
IFIDVPSFEELVNRLKKRRTESETDLQKRIDRAKMELSYKDKFDYIFINKDLEEVTSQIK
SLINEILKKEK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgataaaaagggaaaaataattgttatctcatcacccagtggcggaggaaaaact
acaatcgtaagaaaaattctctctgaattaccagagattgttttctcagtttccgcaact
acaagaccaaaaagaccagatgagattgacggagttcattatttttttctgactgataaa
gaattcgaagagaaaattaagaataatgaatttattgaatgggaaagattttatgattat
tactatggaaccttgaaaacttttgttcttgataatattgaaaaagggaaaactgttctg
ctcgaaattgatgttaaaggcgcaatatctgttaaaaaattattctcggatgcaatttta
atttttatagatgtaccatcatttgaagaattagtaaaccgattaaaaaaacgaagaact
gagagcgaaaccgatcttcagaagagaattgatagagctaaaatggagttgagctacaag
gataaatttgattatattttcattaacaaagatttggaagaagtaacttcgcagataaaa
agtttaataaatgaaatattaaaaaaggagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system