KEGG   Ignavibacterium album: IALB_0986Help
Entry
IALB_0986         CDS       T01943                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ial  Ignavibacterium album
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    IALB_0986 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    IALB_0986 (nagZ)
Enzymes [BR:ial01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     IALB_0986 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089111..1090457
Genome map
AA seq 448 aa AA seqDB search
MKKILLFLLFTQTFLPQTDLYHKISQMIMVGFSGKTLSDSMIVNDLQIRGVGSVILFGGN
IESPTQLNQLTTQIHNLSSTPLFIAIDQEGGRIARLRETNGYTSTYTAYQIGTIFNNESI
NRSWASLMAGWLKDAKINLNLAPVADVNVNPESPAIGFLDRSFSRIPDSVFNHCFWFIDE
FHQKNILNCLKHFPGHGSATTDSHLGFTDITNTWADSELVPYRRLIQNGYNDFIMSGHLF
NAQIDSVYPASLSNKTLTGLLRDSLGFEGLIITDGMFMGAISNNYSFDEAVELAINAGND
ILLYTTNKLSGKSLVDSVVGIVMNKISEGKITEQRINESYNRIIQKKQQLTNVYQSNNDF
IPDDFELSNYPNPFNAQTNILVKVPKDGNLSINVFNTIGEEVAELVNDFKTAGTYNFNFN
ASELASGIYLIRMKMQNKILTHKMVLLK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattctactgttccttttattcactcaaactttcttacctcaaactgatctt
tatcataaaatatcacaaatgataatggttggtttttcagggaaaacattaagcgactca
atgattgtgaatgatttacaaattcgtggtgtaggaagtgtaattttgtttggtgggaat
atcgaatcaccaactcaacttaaccagcttacaacacaaattcataatctttcttcaact
ccattatttatcgctattgatcaggaagggggaagaattgcacgattaagagaaacaaat
ggttacacttcaacatatacagcatatcagataggaacaatttttaacaatgaaagcata
aacagaagctgggcatctttaatggctggttggctgaaagatgctaaaataaatcttaac
cttgcaccagtggctgatgtaaatgttaatcctgaaagtccggcaatcggatttctggac
agaagtttttcacgaattcctgattctgtattcaatcattgcttctggtttattgatgag
ttccatcagaaaaatattttaaattgtctgaaacactttccgggacacggcagcgcaaca
accgattcacatcttggcttcacagatattacaaatacatgggctgattcagaattagtt
ccatatcggagacttatacaaaatggctataatgattttataatgagcggacatcttttt
aacgctcagattgattctgtttatccggcatctctttcaaataaaactttaaccggattg
cttcgtgactcacttggattcgaaggtttgattatcaccgatggaatgttcatgggtgct
atctcaaataattattcatttgacgaagctgtggaacttgcaatcaatgcgggcaatgat
attcttctttacacaacaaataaactttcagggaaatcactagttgatagtgttgtggga
attgtgatgaataaaatttctgaaggcaaaattaccgagcaaagaattaatgaatcgtat
aacagaataattcagaagaagcaacaacttacaaatgtttatcagagcaataatgatttt
attccagatgattttgaattatcaaattatcctaatccttttaatgctcagactaacatt
ttggttaaagtaccaaaagatggaaatctttcaataaatgtttttaatactattggtgag
gaagttgctgaacttgtcaatgactttaaaacagcaggaacttataattttaattttaat
gcaagcgaactagcttcgggcatatatctgataagaatgaaaatgcagaataaaattctt
actcataaaatggtgcttctcaaataa

DBGET integrated database retrieval system