KEGG   Ignavibacterium album: IALB_1053Help
Entry
IALB_1053         CDS       T01943                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ial  Ignavibacterium album
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IALB_1053 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_1053 (glk)
   00052 Galactose metabolism
    IALB_1053 (glk)
   00500 Starch and sucrose metabolism
    IALB_1053 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    IALB_1053 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    IALB_1053 (glk)
   00524 Butirosin and neomycin biosynthesis
    IALB_1053 (glk)
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     IALB_1053 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1182776..1183738
Genome map
AA seq 320 aa AA seqDB search
MAKSEKYAVGVDLGGTNIKVGIVSESGRIISKTSVKTEAMSGPKVVIKNIKKGINEILKN
NKRKISGIGIGAPGIVSTKKGTVQNPPNLPGWDEIELGAIIKKEFGLKVNVENDANAAAI
GELIFGAGKKFESFVMVTLGTGVGGGIVFNHKIFRGEIGGAGEIGHVCIDPNGPRCNCGS
TGCIEAYAGNHYIKESVKKDLHNHPSSKIWELIENDLEKVSPRVIQMAAELGDVYAKEFI
HDLGIKLGVAFTSISNVLDISTFIIGGGVAGFGSPLFTTIKSTMVSRVLTPLKHRIKIVP
AKLKNEAGILGASALVFYNT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatcagaaaaatatgctgttggtgttgacttaggcggaacgaatataaaagtc
ggaatagtctccgaaagcggtagaatcatttctaagacttctgtaaaaacagaagctatg
tcaggaccaaaagttgttattaagaatattaaaaaaggtatcaacgaaattttaaagaac
aacaaaagaaaaatttccggaattggaattggtgcgcccggaattgtttctacaaaaaaa
ggtactgtacaaaatccgcctaatcttccaggttgggatgagattgaacttggagcaatt
atcaaaaaagaatttgggttgaaagttaatgttgagaatgatgctaatgctgctgctatt
ggagaactgattttcggtgccggaaaaaagtttgaatcatttgttatggtaacacttgga
accggcgtcggtggtggaatagtattcaatcataaaattttcagaggagaaattggtggt
gcaggagaaattggtcatgtttgtattgatccaaacggaccaagatgcaactgtggctca
acaggttgtattgaagcatacgcaggaaatcactacataaaagaatcagtaaagaaagat
cttcacaatcatccgtcatcaaaaatctgggaacttattgaaaatgatcttgaaaaagta
tctccaagagtaattcaaatggctgcagaacttggtgatgtttatgccaaagaatttatt
cacgatcttggaattaagcttggagttgctttcacatcaataagtaatgtgcttgatatc
agtactttcattatcggtggaggagtcgccggatttggaagtcctctgttcacaacaata
aaatcaacaatggtttctagagttttaactccacttaaacacaggattaaaattgttcct
gcaaaacttaaaaacgaagcaggaatcctcggtgcatcagcactagtattttataataca
taa

DBGET integrated database retrieval system