KEGG   Ignavibacterium album: IALB_1339Help
Entry
IALB_1339         CDS       T01943                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ial  Ignavibacterium album
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ial00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537043..1537609
Genome map
AA seq 188 aa AA seqDB search
MNKEKFESLIRNILIEIGEDPNREGLLSTPKRVAEAYQFLTAGYQKDIDEVLNNAIFTEK
YDEMVLVKNIDFYSMCEHHMLPFYGKVHVAYIPNGKIVGLSKIPRIVEVFARRLQVQERM
TQQIADTLEKYLQPVGVAVVSEAYHMCMMMRGVEKQNSSATTSAMHGVFKEDAKTRNEFI
NLVGIKNL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaagaaaaatttgaatctctgataagaaacatactaattgaaatcggagaggat
ccaaatcgtgaaggacttctttccactcctaaaagagttgccgaagcatatcaatttctt
actgcaggatatcagaaagatattgatgaagttcttaacaacgccatcttcacagaaaaa
tatgacgagatggttttagtaaagaatattgatttctatagtatgtgtgaacatcatatg
cttccgttttacggaaaagttcatgttgcatacattccaaacggaaagattgttggttta
agtaagattccgagaattgtcgaagtattcgcacgaagattacaggtccaggaaaggatg
actcagcagattgccgatacactcgaaaaatatcttcagccggttggagttgctgtggtt
tccgaagcatatcatatgtgtatgatgatgcgcggagttgaaaaacagaattcttcagca
actactagcgctatgcacggtgtattcaaagaagatgcaaaaacaagaaatgaatttata
aacttagtaggaatcaaaaatctttaa

DBGET integrated database retrieval system