KEGG   Ignavibacterium album: IALB_1649Help
Entry
IALB_1649         CDS       T01943                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ial  Ignavibacterium album
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IALB_1649 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IALB_1649 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    IALB_1649 (sucB)
Enzymes [BR:ial01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     IALB_1649 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1876358..1878052)
Genome map
AA seq 564 aa AA seqDB search
MDIIMPKMGESVSEGTIIKWHKKAGDKVKRDEIIFEISTDKVDTEIPAPENGILSEILVN
EGETVQVGTVVARLQTEGGEVVQKAEPKIVEDVSPVQKVEEVVERKDESKYVTSSANTNG
NIIEIAMPKMGESVMEGTIIKWHKKVGDKVKKDETIFEISTDKVDTEIPSPEEGTLIEIL
VGEQETVEVGTIVAKLAVGSDVVISKPVVEASPKSEIKVEETVSMHDNFSAMRETREELS
VETDRFYSPLVLSIAEKENVSFEELRKISGSGIDGRVTKKDILTYIEQRKSKTGKVQETI
TKTPQQQVSKTAALAPSFIPETSSTYSSGDVIKIPMDNIRMKIMEHMVHSRDTSVHVTSM
IEADITLIHNFINQKKDEYLQKENVKLTYMAFIADAVVKSLKKYPLLNSTIDGNTILQKK
FINLGIAVAIEPTGLIVPNIKGAGERNIIGLAKAIADLANRARTKKLTPDDISNGTFTIT
NYGVFGTIFGTPIINQPEVAILGVGTVQKKPVVVEVNGLDSIAVRHIVALTLSHDHRLID
GMLGGLFLKSIKDILENFDPENFN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatatcataatgccgaaaatgggtgagagtgttagcgaaggcactatcatcaaatgg
cataaaaaagccggagataaagtaaaacgagatgaaataatttttgaaatcagtacagat
aaagttgatactgaaattcccgctcccgaaaatggaattttatctgaaatcctggttaat
gaaggtgagactgttcaagtcggaactgttgttgccagacttcaaactgaaggtggtgaa
gttgttcaaaaggcagaaccaaaaattgtagaagatgtatctccggttcaaaaagtagag
gaagttgttgagcgaaaagatgaatcaaaatatgtgacatcatctgcaaacactaacggt
aatataatcgaaatcgcaatgcctaaaatgggtgaatcagttatggaaggtacgatcatc
aaatggcataaaaaagtcggcgataaagtaaagaaagatgaaactatatttgaaatcagc
acagataaagttgatactgaaattccatcacctgaggaagggactttgattgaaattctt
gtcggtgaacaggaaaccgttgaagtaggaacaattgtagcaaaacttgctgttggaagt
gatgtagttatatcaaaacctgtcgttgaagcttcaccaaaatcagaaattaaagttgaa
gagacagtttcaatgcacgataacttttctgcaatgagagaaacacgagaagaattatct
gttgaaacagacagattttattctccgttggttttaagtatagcagaaaaagaaaatgtt
agttttgaggagctaagaaaaatatcaggcagtggaatagacggaagagtgacaaagaaa
gatatactaacatatatcgaacagagaaaatcaaaaacaggtaaagttcaggaaacaata
actaaaacaccacagcaacaagtcagtaaaacagctgctctggcaccttcattcattcct
gaaacttcgtcaacatattcctcaggtgatgttattaaaattccaatggataacatcaga
atgaagataatggaacatatggttcatagccgcgatacttcggttcatgttacaagtatg
attgaagctgatattacattgattcacaattttatcaatcagaaaaaggatgaatatctt
cagaaagaaaatgttaaacttacatatatggcattcattgccgatgcggtggtgaaatcg
ctgaaaaaatatcctttgcttaattcaaccattgatggaaatacaattctccaaaagaag
ttcattaatcttggaattgctgttgcaattgaaccaacgggtttaattgttccaaatatt
aaaggagctggcgaaagaaacataatcggtttagcaaaagcaattgcagatttagcaaat
cgtgcaagaaccaaaaagcttacaccggatgatatttccaacggaacatttacaattaca
aattacggtgtcttcggaacgattttcggaactccaataatcaatcagcctgaagttgca
attcttggtgtcggaactgttcagaaaaaacctgtcgttgtggaagtaaatggattagat
tcaatcgccgtcagacatattgttgcattaactttatcacacgatcatagactaattgat
ggtatgttaggagggctattcctgaaatcaattaaagatattctggagaattttgatccg
gaaaattttaactaa

DBGET integrated database retrieval system