KEGG   Ignavibacterium album: IALB_1704Help
Entry
IALB_1704         CDS       T01943                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ial  Ignavibacterium album
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ial00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ial00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1936315..1937580)
Genome map
AA seq 421 aa AA seqDB search
MDKFIIHGGKKLKGSVKVSGAKNASLALMPATLVNNGINKLYNTPELNDVYTMLKLLSQM
GVKYSFNNHLLELDTSSITSYEAPYEHVKKMRASIYVLGPLLARYGYAKVSMPGGCAWGP
RPVNLHLMAMEKLGAEIQLDQGYIIARSNRLKGNYINFDIPSVGATGNTLMAAVLAKGNT
IINNAACEPEITNLCNYLIKMGAKINGIGTSILEVEGVDELKPAEIETIPDRIEAGTLLI
AGAITRGNIRVIGGVTHHLHSLLSKLEDSGCKLAYNKDYIEINAEDVEVSPVDVTTAVFP
GFPTDMQAQWIAYMSLANGTSNVTDTIYTDRFNHVPELVRLGADIIVHENTARIVGVKRL
TGAKVMSTDLRASASLVLAGLAAEGTTEVLRVYHIDRGYQKIEEKLKTLGADIERVEGSE
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttggataaatttattattcacggcggaaaaaaacttaaaggaagtgttaaagttagtggt
gcaaaaaatgcatctttagctttaatgcctgccactttagttaataatggaataaacaag
ctctataatactcctgaattgaatgatgtttatacaatgttgaaattattatcgcaaatg
ggagttaagtattcttttaataatcatttacttgaattagatacatccagcataacaagt
tatgaggcgccttatgaacatgtgaagaaaatgagagcttcaatttatgtgcttggtcca
ttattggctcgctatggatatgcaaaagtttctatgccaggcggatgtgcctggggacct
cgaccagtgaatttacatttaatggcaatggaaaaacttggtgcagaaattcagcttgat
caaggttatatcattgcaagatcaaatcgattaaaaggtaattacattaactttgatatt
ccctcagttggtgctaccggaaacactttaatggctgcagtactcgcaaaaggaaatact
ataatcaataacgccgcttgtgaacctgagattacaaatctttgtaattacctgataaag
atgggagcaaaaattaatggtattggaacttctattcttgaagttgaaggtgttgatgaa
ttaaagcccgccgaaattgaaactattccggatagaattgaagctggtacacttttaatc
gctggtgcaattacaagaggtaatatcagagttatcggtggagtaactcatcatttacat
tcactcttatctaaacttgaagacagtggatgtaagttggcttacaataaagattatatc
gaaatcaatgctgaagatgttgaagtaagtcctgttgatgttacaacagctgtctttccg
ggatttcctacagatatgcaagctcaatggattgcttatatgtcacttgctaatggtact
tcaaatgttacggacacaatttatacagatagatttaatcatgtacctgaattagtaaga
ttaggtgctgacattattgtacacgaaaacactgcaagaattgtaggtgtaaaaagacta
actggagcaaaagtaatgtcaactgatttaagagccagcgcttctcttgttcttgctggt
cttgcagcagaaggtacaactgaagttttacgagtttatcatattgacagaggttatcag
aaaattgaagagaagctgaaaactttaggtgctgacattgaaagagttgagggtagtgaa
tattaa

DBGET integrated database retrieval system